KEGG   Actinoplanes missouriensis: AMIS_33480Help
Entry
AMIS_33480        CDS       T01795                                 

Definition
putative glycosyl hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ams  Actinoplanes missouriensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3522502..3523530
Genome map
AA seq 342 aa AA seqDB search
MTAELATGRPGRRNRIRLFTAAACTAVMAVAGLAFTGVAHAEADRTVTSSITGTHNGYYF
SFWKDSGDASMTLLADGRYTSRWNTSTNNWVGGKGWATGTRRTVTYSGTYNPGNNNTYLA
LYGWTRNPLIEYYVVENFGSYNPSSGAQRLGTVTTDGGTYDILRSQRVNQPSIDGIQTFY
QYWSVRQQKRSSGTITTANHFDAWARAGLNLGTNHSYQVMATEGYQSNGSSDITVREGGG
SGPTNPTSPTPGNPGSNCTAVLSAGQQFGDRFNLNVAVSGTNSWTVTLNLNGGQSIQNSW
NAGVTGTTGSVTARPNGNGNNFGVTIMANGNWTWPTVTCRTS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagaactcgccaccggaagacccgggcggcgcaaccgcatccgcctcttcacc
gcggccgcctgtaccgccgtgatggcggtcgccggtctggccttcaccggcgtcgcgcac
gccgaagccgaccggaccgtcacctccagcatcaccggcacccacaacggctactacttc
tcgttctggaaggacagcggcgacgcgagcatgaccctgctcgccgacggccgctacacc
agccgctggaacaccagcacgaacaactgggtcggcggcaagggctgggccaccggcacg
cgccggacggtgacctactcgggcacctacaacccgggcaacaacaacacctacctggcc
ctgtacggatggacccgcaacccgctgatcgagtactacgtcgtcgagaacttcggcagc
tacaacccgagcagcggcgcgcagcggctgggcaccgtcaccaccgacggcggcacctac
gacatcctgcgcagccagcgggtcaaccagccctcgatcgacggcatccagacgttctac
cagtactggagcgtccgccagcagaagcgctccagcggcacgatcaccaccgcgaaccac
ttcgacgcctgggcgcgggccggcctgaacctcggcaccaaccacagctaccaggtgatg
gcgaccgagggttaccagagcaacggcagctcggacatcacggtccgggagggcggcggc
tccggcccgacgaacccgaccagccccacccccggcaacccgggcagcaactgcacggcg
gtgctctccgccggtcagcagttcggtgaccggttcaacctcaacgtcgcggtcagcggc
acgaacagctggaccgtcacgctcaacctgaacggcggccagagcatccagaacagctgg
aacgccggcgtgacgggtacgaccgggagcgtcaccgccaggccgaacggcaacggcaac
aacttcggcgtgacgatcatggcgaacggcaactggacgtggcccacggtcacctgccgg
acgagttag

DBGET integrated database retrieval system