KEGG   Actinoplanes missouriensis: AMIS_33690Help
Entry
AMIS_33690        CDS       T01795                                 

Definition
putative branched-chain alpha-keto acid dehydrogenase E2 subunit
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_33690
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_33690
   00020 Citrate cycle (TCA cycle)
    AMIS_33690
   00620 Pyruvate metabolism
    AMIS_33690
Enzymes [BR:ams01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AMIS_33690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3544430..3545884)
Genome map
AA seq 484 aa AA seqDB search
MNTFTLPDLGEGLTEAEIVRWLVAEGDVIEVDQPVVEVETAKAMVEVPSPHAGRVATRHA
AEGTTLAVGEPLITVAAVASALASEAASAVASALASEAASAAGEAYREEERAGSGNVLIG
YGTKPGTGATRHRRPKGRTSPAGPAASGGSPVSSAPSPSAVASASPVSSPSVVASPSVVA
SGSVVAAGRPARVASPLVRRLARESGVDLSALRGTGPGGVITRQDVEAAGRPVAAAPVAA
APVTTAAVTAAPVAAAPVAAISAVAGERRIPLSGFRKAASAVLSRSRAEIPEATVWVDVD
ATPLWELRQRTEPGLLAYVARFVVAGLRKYPVLNARLDTERQEIVELDEINLGIAVQSDR
GLVVPAVAGAQAMTTSMLDAAIRDVTARARRGESTVPGTFTLNNYGAFRVDGSAPIINHP
QVAMLGLGRIIDRPWVVDGALTVRKIAQLSFVFDHRVCDGGTAAGFMRVVADAIEDPASA
LAAL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacgttcaccctgcccgacctgggcgaaggcctgaccgaggcggagatcgtgcgc
tggctggtcgccgagggcgacgtgatcgaggtcgatcagccggtggtcgaggtggagacc
gcgaaggcgatggtggaggtgccgtccccgcacgccggacgggtcgcgacccggcacgcc
gccgagggcacgacgctcgccgtcggtgagccgctgatcacggtggcggcggtggcttca
gcgctggcttcggaggcggcttcggcggtggcttcggcgctggcttcggaggcggcttcg
gcggccggcgaggcctatcgcgaggaggagcgggccggttccggcaacgttctcatcggg
tacgggaccaagcccggcaccggggcgacccggcatcggcggccgaaggggcggacgtcg
ccggccgggcctgccgcttcgggcggctcgcccgtgtcttccgccccttccccgtctgct
gtggcgtccgcgtctcccgtgtcgtccccgtctgtcgtggcgtccccgtccgtcgtggcg
tccgggtccgtcgtggcggcggggcggccggctcgggtggcgtcgccgctggtgcggcgg
ctggcccgggagagcggcgtggatctgtccgcgctgcggggcaccgggccggggggtgtg
atcacccgtcaggacgtggaagcggccgggcggcccgtcgccgcggcccccgtcgccgcg
gctcccgtcactacggccgccgtcactgcagctcccgtcgctgcggctcccgtcgctgcg
atttcggccgtcgcgggtgagcggcgcatcccgctcagcgggttccgcaaggcggcgtcg
gcggtgctcagccgcagccgggccgagattcccgaggcgaccgtctgggtggacgtcgac
gccacacccctgtgggagctgcggcagcgcaccgaacccggcctgctcgcctacgtggcc
cgcttcgtcgtcgccggactgcggaagtatcccgtgctcaacgcccgcctcgacaccgaa
cgccaggagatcgtcgaactcgacgagatcaacctggggatcgcggtccagtccgaccgg
ggcctggtcgtcccggcggtcgcgggcgcgcaggcgatgaccacgagcatgctggacgcg
gcgatccgggacgtgacggcccgtgcccgccgcggcgagtccaccgtgccgggaacgttc
accctcaacaactacggagcgttccgcgtcgacggcagcgccccgatcatcaaccacccc
caggtggccatgctcggcctgggccggatcatcgaccggccgtgggtggtggacggggct
ctgaccgtacggaagatcgcgcagttgtccttcgtctttgaccatcgcgtgtgcgacggg
ggcaccgccgcgggcttcatgcgcgtggtggccgacgcgatcgaggacccggcctccgcc
ctggcagcgctgtga

DBGET integrated database retrieval system