KEGG   Actinoplanes missouriensis: AMIS_34120Help
Entry
AMIS_34120        CDS       T01795                                 

Definition
putative M20/M25/M40-family peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ams  Actinoplanes missouriensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMIS_34120
  Amino acid metabolism
   00300 Lysine biosynthesis
    AMIS_34120
Enzymes [BR:ams01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AMIS_34120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3581894..3582961)
Genome map
AA seq 355 aa AA seqDB search
METLLAAVERLIGIRSTADRPDELRRALDFVLDLVGPGFEVRRFEAGGKPSALVTTGPQT
PRVILNAHLDVVPGTDAQFVPRRDGDRLYGRGTHDMKAAAVVLATVFRDCARSLPHPIAL
QLVTDEEVGGFDGTGHQVAQGVRADFVIIGEQSGLRIVTESKGILRVRLDASGRTAHAAY
PWLGTNALVAVTEAVGRLLARYPVPPSESWTTTVNVARIQTSNIAANIVPADASALLDIR
FPPSDPDLTSGDVAAYLASVAGPDVRVTVEAQGAPHAADPASAFVRRLRSAAQAQGYEGT
LLRKHGAADGRFYSAHGVDAVIFGPGGDGQHGPEEYLDVRTLIPYREALMVFLRG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcttctcgcggcggtggagcggctgatcgggatccggtccaccgcggaccgg
cccgatgagctgcggcgcgccctggacttcgtgctcgacctggtcggaccgggtttcgag
gtgcgccgcttcgaggcgggcggcaagccgagcgccctggtcaccacgggtccgcagacg
ccccgggtgatcctcaacgcgcacctcgacgtggtgccgggcaccgacgcccagttcgtc
ccgcgccgcgacggcgaccggctctacgggcgcggaacgcacgacatgaaagcggcagcc
gtcgtgctggcgacggtgttccgggactgcgcccggtcgctgccccacccgatcgcgctg
caactggtcaccgacgaggaggtcggcggtttcgacgggaccggccaccaggtcgcccag
ggcgtccgcgccgacttcgtgatcatcggggagcagagcgggctgcgcatcgtcaccgaa
tccaagggcatcctccgggtgcggctggacgcgtccgggcggaccgcgcacgccgcctat
ccgtggctggggacgaacgccctggtcgcggtcaccgaggcggtggggcggctgctcgcc
cgctaccccgtcccgccgtccgaatcgtggaccaccacggtgaacgtggcacggatccag
acgtcgaacattgccgccaacatcgtcccggccgacgcgtcggcgctgctcgacatccgg
ttcccgccgtccgacccggacctgacctcgggcgacgtcgccgcctacctcgcatcggtg
gccgggccggacgtgcgggtcaccgtggaggcgcagggcgcgccgcatgccgccgacccg
gcgagcgctttcgtccgccggttgcggtccgcggcccaggcacaggggtacgaggggacg
ctgctccgcaaacacggcgccgccgacgggcggttctactcggcgcacggggtggacgcg
gtcatcttcggtcccggcggggacggccagcacgggccggaggagtacctggacgtgcgc
actctcatcccataccgggaggctctgatggtttttcttcgcgggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system