KEGG   Actinoplanes missouriensis: AMIS_3640Help
Entry
AMIS_3640         CDS       T01795                                 

Definition
(GenBank) putative tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMIS_3640
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMIS_3640
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMIS_3640
Enzymes [BR:ams01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMIS_3640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
382620..383936
Genome map
AA seq 438 aa AA seqDB search
MSDLVLPAERVMAEPGELGRFGEHGGRFVPESLVPACARLEEGFREAWSDPSFHRDLERL
LTVYAGRPTALTPAWRLSAELGITVLLKREDLAHTGSHKINNVLGQALLARRMGKTRLLA
ETGAGQHGVATATAGALLGLGVTVYMGEKDIERQALNVFRMKMLGAEVVPVTSGSRTLKD
ATSEAMRAWVTCLDEAHYCLGSVMGPHPYPWMVREFQRVIGDEARRQSAAELSTGIPDYV
VACVGGGSNAAGTFAGFADTGARLIGVEAAGGAAVASGRTGVLHGFRSYLLQDENGQVSE
AHSIAPGLDYPGVGPEHAYLNDIGRARYVTVSDEEVVPAVHRLARTEGILPALESAHAIA
WVIRAAESGELPPFSTVLVTLSGRGDKDVATLMEAPAPTGAPAPTGAPVPTGAPVPTGAP
APMEAPALKEAPALKEEQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcttgtgctgcccgcggagcgggtgatggcggagccgggggagctcggacgc
ttcggtgagcacggtgggcgcttcgtcccggagtcgctggtgccggcgtgcgcccggctc
gaggaggggttccgcgaggcctggtccgacccgagtttccaccgtgacctggaacggctg
ctgaccgtgtacgccgggcggccgaccgcgctcaccccggcctggcggctctccgcggag
ctcgggatcaccgtgctgctcaagcgcgaggacctggcgcacaccggctcccacaagatc
aacaatgttctcggtcaggcgctgctggcccgccggatgggcaagacccggctgctcgcc
gagaccggcgccggccagcacggcgtcgccaccgcgaccgcgggcgcgctgctcgggctc
ggtgtcaccgtctacatgggtgagaaggacatcgagcggcaggcgctgaacgtcttccgg
atgaagatgctcggcgccgaggtggtgccggtgaccagcggcagccgcacgctcaaggac
gccaccagcgaggccatgcgggcgtgggtcacctgcctggacgaggcgcactactgcctc
ggctcggtgatggggcctcacccgtacccctggatggtccgggaattccagcgggtcatc
ggggacgaggcgcggcggcagagcgcggccgagctgagcaccgggatccccgattacgtg
gtcgcgtgcgtgggtggcggctccaacgcggccgggacgttcgccgggttcgcggacacc
ggcgcgcggctgatcggtgtggaggcggccggtggcgcggctgtcgcgtcggggcggacc
ggtgtgctgcacggcttccggtcatatctgctgcaggacgagaatgggcaggtcagcgag
gcgcactcgatcgcgccggggctggactatccgggtgtggggccggagcacgcctacctc
aacgacatcggccgggctcgttacgtcacggtgagcgacgaagaagtggtgcctgcggtg
catcggctcgcccgtaccgaaggaattctgcctgctctggagtccgcccatgcgatcgcc
tgggtgatccgggccgccgagtccggtgaactgccgccgttctccaccgtgctcgtgacg
ctctccggccggggcgacaaggacgtggcgacattgatggaggccccggctcccacgggg
gccccggctcccacgggggccccggttcccacgggggccccggttcccacgggggccccg
gctcccatggaggccccggctctcaaggaggccccggctctcaaggaggaacagtga

DBGET integrated database retrieval system