KEGG   Actinoplanes missouriensis: AMIS_3650Help
Entry
AMIS_3650         CDS       T01795                                 

Definition
(GenBank) putative tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMIS_3650
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMIS_3650
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMIS_3650
Enzymes [BR:ams01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMIS_3650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
383933..384670
Genome map
AA seq 245 aa AA seqDB search
MKGLVPYLTGGIRPDWTRYLREYERNGATAIEIGLPFSDPILDGPTIQEASDRALRAGAS
VATILAEVAATKMTIPLIAMTYYNLVVHRGPELFCRELADAGITGLIVPDLPIDEAGALA
AAAEKHGVDLTLLAAPTTQPDRLAEIARRSRGFIYAISVMGTTGERDQIAESGIRLAGEL
RRLTDKPVLLAFGISRPEHAAAAAGVCDGVVVGAALMRRILDGGTPEELGAVLGGFRRAL
DSVAV
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggtctggttccctatctgaccggcggcatccggccggactggacgcgctacctg
cgggagtacgagcgcaacggcgccaccgcgatcgagatcggcctgccgttctcggatccg
atcctggacgggccgacgattcaggaggcctccgatcgggcgctgcgcgccggcgcctcg
gtcgccacgatcctcgcggaggtcgccgccacgaagatgaccattccgctgatcgcgatg
acgtactacaacctggtcgtccaccgcgggccggaattgttctgccgcgagctcgcggac
gccggcatcaccggtctgatcgtgccggacctgccgatcgacgaggcgggcgccctcgcc
gcagccgccgagaagcacggcgtcgacctgaccctgctggccgcgcccaccacccagccg
gaccgtctcgccgagatcgcccggcgcagtcgcggcttcatctacgcgatctcggtgatg
ggcaccaccggcgagcgtgaccagatcgccgaatccggcatccggctcgccggtgagctg
cgcagactcaccgacaagccggtgctgctggcgttcgggatctcccggccggagcacgcg
gcggccgccgccggtgtctgcgacggcgtggtggtcggcgccgctctgatgcgccgcatc
ctggacggcgggaccccggaggagttgggtgcggttctcggcgggttccgcagggccctc
gatagtgtggcggtctga

DBGET integrated database retrieval system