KEGG   Actinoplanes missouriensis: AMIS_40360Help
Entry
AMIS_40360        CDS       T01795                                 

Definition
putative glycosyl hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ams  Actinoplanes missouriensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMIS_40360
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AMIS_40360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4265346..4266539
Genome map
AA seq 397 aa AA seqDB search
MPVIRDRIASQPASHWLSNFNQSTIRSEVSGYVGAANAAGQIPVLTVYGITNRDCGGASS
GGAPDLTQYQTWISNLAGGLGNRTVVIILEPDSIALQTCLSGADLAARNQALHTAVRTLK
SGNPSSKIYLDAGHSTWNSAAEQARRLIAAGIADADGFYTNVSNFNPTSGEASYGRSIIS
SLSAQGVSGKRQVIDTSRNGGASGDWCGDDNTDRRIGRYPTVATGDDNIDGYLWVKPPGE
ADGCRYAAGSFQPDLAYSLASSATNPPSPSPSNPSSSPSSSPSSSPSGSPSASPSASQPT
GACSATFRVTGSWQGGFQGEVTVTAGTAALSGWSVSWPLSAGQTITQAWNGTLSATGSTV
TVRNVSWNGALAPRATAQFGFLANGAATTPTLTCAAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcattcgcgaccggatcgcgagccagccggcgtcccattggctgtcgaacttc
aatcaatccacgatcagatccgaagtttccggatatgtcggtgcggcgaatgcggccggg
cagattccggttctgaccgtttacggcatcacgaaccgcgactgcggcggcgccagctcc
ggcggcgcccccgacctgacgcagtaccagacctggatctccaatctggccggaggtctc
ggcaaccggaccgtcgtgatcatcctggagccggactcgatcgccctgcagacctgcctc
agcggcgccgacctggccgcccgcaaccaggcgctgcacaccgcggtccgcaccctgaag
tcgggcaacccgagttccaagatctacctcgacgccgggcactccacctggaacagcgcc
gccgagcaggcccgccgcctgatcgcggccggcatcgccgacgccgacggcttctacacc
aacgtctccaacttcaacccgacgagcggcgaggcgtcctacgggcgctcgatcatcagc
tcactctccgcgcagggcgtgtccggcaagcgccaggtgatcgacacgagccgtaacggc
ggcgcgagcggcgactggtgcggcgacgacaacaccgaccgccggatcggccgttacccg
acggtggccaccggcgacgacaacatcgacggatacctgtgggtcaagccgccgggcgag
gccgacggatgccgttacgcggccggctccttccagcccgacctcgcctacagcctggcg
agcagcgccaccaacccgccctcaccgtccccgtcgaacccctcgtcaagcccctcgtca
agcccgtcttcgagcccgtcgggcagcccgtccgccagcccgtcggcgagccagccgacc
ggtgcctgctccgccacgttccgcgtcaccggctcctggcagggcggcttccagggtgag
gtcaccgtcaccgcgggcaccgcagccctctccggctggtccgtctcctggccgctgagc
gccggccaaaccatcacccaggcctggaacggaacactctccgcaaccggctccaccgtc
accgtccgcaacgtctcctggaacggcgccctggcaccacgagccaccgcccaattcggc
ttcctcgccaacggcgccgccaccacacccacgctcacctgcgccgcggcctga

DBGET integrated database retrieval system