KEGG   Actinoplanes missouriensis: AMIS_43620Help
Entry
AMIS_43620        CDS       T01795                                 

Definition
putative glycosyl hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ams  Actinoplanes missouriensis
Brite
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     AMIS_43620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4574805..4576520)
Genome map
AA seq 571 aa AA seqDB search
MVGNGMRIHPRAWLAAAVAVAVATGAWAAVSTGDDASPDDRTAADVLTGHDWTHVAGGTA
GSGGVRIVGLGRRIVQQDGSGGQPNPPVNLRGPRLAVRGPVEITAGVDRPAGRSAVLTLY
GDVPVVYDEWRHNPPGLAVTVTDGELRLEVWDGRGNDPAVRRRATLAAPAAATVTVTRAG
GRLTVRLGDARLSVTDPGVFSSGRVFFGADADDSGPDGWTLTSLRAAGLDGGSATVVDAP
ALDQSAPPPGSLRALAAARRALPIGAAVAAEPLLADDGYRRLTAAQFSMLTTENALKPQF
VHPQPDRYDFTGGDLLVDFAAANDMAVHAHTLVFGEANPRWMQDAPADRRERIMLDHIST
VVGHYRGRVAEWDVVNEPLSTESEDYEDGGTGLRRHLWQQAMGEAYIDTAFAAARTADPG
AKLYLNDFGLEADGERWDALLGLVGRLKQRGVPIDGVGFEAHIHEAGDRVTAAVLQDHFA
ELARLGLSARVSEIDVYGDPAAGQAEQYATVLTACLAAPNCTSYTTWGVTDRYGSTTESD
TYPPQPGDDLLFDRNLAPKAAFTALTRVLRG
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggtaggaaatggcatgcggatacatccccgggcctggctggcggccgcggtcgccgtg
gcggtggcgaccggcgcgtgggcggcggtcagcaccggcgacgacgcgtcgcccgacgac
cgtaccgccgccgatgttctcaccggccacgactggacgcatgtcgccggaggcaccgcc
ggctccggcggggtgcggatcgtcgggctgggaaggcggatcgtgcagcaggacggctcc
ggcggccagccgaacccgccggtcaatctgcgcgggccgcggctcgcggtgcgcggcccg
gtggagatcaccgccggggtggatcggccggccggccggtcggccgtgctcaccctgtac
ggcgatgtgccggtggtttacgacgagtggcggcacaatccgcccgggctggccgtcacc
gtcaccgacggggagctgcgcctggaggtctgggacgggcggggcaacgatccggcggtc
cgccgccgggccacgctggccgcacccgctgcggccacggtgaccgtcacccgggccggt
gggcggctcacggtccggctcggtgacgcccgcctgtccgtcaccgaccccggggtgttc
agctccggacgggtgttcttcggcgccgacgccgatgacagcgggccggacggctggacg
ttgacctcgttgcgggccgccgggctggacggcggcagcgccaccgtcgtcgacgccccg
gcgctcgaccagtcggcgcccccgcccgggtcgctgcgggcgctcgccgcggcccgccgg
gcgctgcccatcggcgccgccgtggccgccgagccgctgctggccgacgacggataccgc
cgtctgaccgccgcccagttctccatgctgaccacggagaacgcgctgaagccacagttc
gtccacccgcagccggaccgctacgacttcaccgggggcgacctgctggtcgacttcgcg
gcggccaacgacatggcggtgcacgcccacaccctggtcttcggcgaggccaacccgcgc
tggatgcaggacgccccggccgaccggcgcgagcggatcatgctcgatcacatcagcacc
gtggtcggtcactaccgcggccgggtcgccgaatgggacgtcgtcaacgaaccgctgtcc
accgagagcgaggactacgaggacgggggaacggggctgcggcggcacctgtggcagcag
gcgatgggggaggcgtacatcgacacggcgttcgcggcggcccggaccgccgaccccggc
gccaagctgtacctcaacgatttcggcctggaagccgacggtgagcgctgggacgcgctg
ctcggcctggtcggccgcctcaagcagcggggggtgccgatcgacggggtcgggttcgag
gcgcacatccacgaggcgggcgaccgggtcaccgcggccgtccttcaggatcacttcgcg
gaactggcccggctcgggctgtcggcccgagtgtccgagatcgatgtgtacggcgatccg
gccgccgggcaggccgagcagtacgccaccgtgttgaccgcctgcctggccgccccgaac
tgcacctcgtacaccacctggggggtcaccgaccggtacgggtccaccaccgagtccgac
acctatccgccgcagcccggtgacgacctgctcttcgaccggaacctggcgcccaaggcc
gcgttcaccgccctgacccgggtgctgcgcggctga

DBGET integrated database retrieval system