KEGG   Actinoplanes missouriensis: AMIS_46740Help
Entry
AMIS_46740        CDS       T01795                                 

Definition
putative glycine cleavage system T protein
Orthology
K00605  
aminomethyltransferase [EC:2.1.2.10]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycine, serine and threonine metabolism
One carbon pool by folate
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ams01200]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ams00260]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ams00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4899367..4900548)
Genome map
AA seq 393 aa AA seqDB search
MTERGRPQPVTTLEPPVRRTALFDVHTRLGAHLTTFAGWTMPLRYGSDIAEHHTVRTAAG
LFDLSHMGRIEVTGRNAAEFLDYALAGRLSTVKVGRAKYTMLCHTTGGVLDDLVVYRLAA
DRFLVVANAANAPMVRAMLGEHANGFAVRITDAGGSLIAVQGPASAEVIATQGPASAEVI
ATQGPASAKAMAIESLDLPYYGITEARVAGCDVLLARTGYTGEDGFEIYCSDADAATIWE
SLRESGATPAGLACRDTLRLEAGMPLYGHELTVRTTPFHAGLGRIVALDKADFVGAESLR
RVAAQGPSTVLTGLVTAGRRAPRSGHAVLDPVSGERIGEVTSGAPSPTLGHPIAMAYVPP
VFAAPGTRLVVDVRGTREDAEVVALPFYRRSPQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcgagggaggccccaacctgtcacgaccttggagcctcccgtgagacgcact
gcgctcttcgacgtccacacgcgcctcggcgcgcatctgaccacgttcgccggctggacc
atgccgctgcggtacggcagtgacatcgccgagcaccacaccgtgcggaccgccgcgggg
ctcttcgacctcagccacatgggccgcatcgaggtcaccggccgcaacgccgcggaattc
ctcgactacgccctcgccggccgtctctcgacggtcaaggtcggccgcgccaagtacacg
atgctctgccataccaccggcggcgtcctcgatgacctggtcgtctaccggctcgcggcc
gaccggttcctggtggtggcgaacgcggcgaacgccccgatggtccgggccatgctcggc
gagcacgccaacgggttcgcggtccggatcaccgacgccggcggctcgctgatcgcggtg
cagggccccgcatcggcggaagtgatcgccacgcagggccccgcatcggcggaagtgatc
gccacgcagggccccgcatcggcaaaagcgatggccatcgagagcctcgacctgccctat
tacggcatcaccgaggcgcgggtcgccggctgtgacgtgctgctggcccgcaccgggtac
accggcgaggacggcttcgagatctactgctcggacgccgacgccgcgaccatctgggag
agcctgcgggagagcggcgccacccccgccggtctggcctgccgggacacgctgcgcctg
gaggcgggcatgcccctgtacgggcacgagctcaccgtccgcaccacccccttccacgcc
gggctgggccggatcgtcgccctggacaaggcggacttcgtgggcgccgagtcgctgcgc
cgcgtcgccgcccaggggccgtcgaccgtgctgaccggcctggtcacggccggccgccgc
gcgccacgcagtggccatgcggtgctcgatccggtcagcggcgagcggatcggcgaggtg
accagtggcgcgccgtcgccgacgcttggtcacccgatcgccatggcctacgtcccaccc
gtgttcgcggcgcccggcacccgtctggtcgtcgacgtccgtggcacccgcgaggacgcc
gaggtcgtcgcgctgcccttctaccgcaggagcccccagtga

DBGET integrated database retrieval system