KEGG   Actinoplanes missouriensis: AMIS_46740Help
Entry
AMIS_46740        CDS       T01795                                 

Definition
(RefSeq) putative glycine cleavage system T protein
  KO
K00605  
aminomethyltransferase [EC:2.1.2.10]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_46740
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AMIS_46740
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMIS_46740
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AMIS_46740
Enzymes [BR:ams01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     AMIS_46740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4899367..4900548)
Genome map
AA seq 393 aa AA seqDB search
MTERGRPQPVTTLEPPVRRTALFDVHTRLGAHLTTFAGWTMPLRYGSDIAEHHTVRTAAG
LFDLSHMGRIEVTGRNAAEFLDYALAGRLSTVKVGRAKYTMLCHTTGGVLDDLVVYRLAA
DRFLVVANAANAPMVRAMLGEHANGFAVRITDAGGSLIAVQGPASAEVIATQGPASAEVI
ATQGPASAKAMAIESLDLPYYGITEARVAGCDVLLARTGYTGEDGFEIYCSDADAATIWE
SLRESGATPAGLACRDTLRLEAGMPLYGHELTVRTTPFHAGLGRIVALDKADFVGAESLR
RVAAQGPSTVLTGLVTAGRRAPRSGHAVLDPVSGERIGEVTSGAPSPTLGHPIAMAYVPP
VFAAPGTRLVVDVRGTREDAEVVALPFYRRSPQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcgagggaggccccaacctgtcacgaccttggagcctcccgtgagacgcact
gcgctcttcgacgtccacacgcgcctcggcgcgcatctgaccacgttcgccggctggacc
atgccgctgcggtacggcagtgacatcgccgagcaccacaccgtgcggaccgccgcgggg
ctcttcgacctcagccacatgggccgcatcgaggtcaccggccgcaacgccgcggaattc
ctcgactacgccctcgccggccgtctctcgacggtcaaggtcggccgcgccaagtacacg
atgctctgccataccaccggcggcgtcctcgatgacctggtcgtctaccggctcgcggcc
gaccggttcctggtggtggcgaacgcggcgaacgccccgatggtccgggccatgctcggc
gagcacgccaacgggttcgcggtccggatcaccgacgccggcggctcgctgatcgcggtg
cagggccccgcatcggcggaagtgatcgccacgcagggccccgcatcggcggaagtgatc
gccacgcagggccccgcatcggcaaaagcgatggccatcgagagcctcgacctgccctat
tacggcatcaccgaggcgcgggtcgccggctgtgacgtgctgctggcccgcaccgggtac
accggcgaggacggcttcgagatctactgctcggacgccgacgccgcgaccatctgggag
agcctgcgggagagcggcgccacccccgccggtctggcctgccgggacacgctgcgcctg
gaggcgggcatgcccctgtacgggcacgagctcaccgtccgcaccacccccttccacgcc
gggctgggccggatcgtcgccctggacaaggcggacttcgtgggcgccgagtcgctgcgc
cgcgtcgccgcccaggggccgtcgaccgtgctgaccggcctggtcacggccggccgccgc
gcgccacgcagtggccatgcggtgctcgatccggtcagcggcgagcggatcggcgaggtg
accagtggcgcgccgtcgccgacgcttggtcacccgatcgccatggcctacgtcccaccc
gtgttcgcggcgcccggcacccgtctggtcgtcgacgtccgtggcacccgcgaggacgcc
gaggtcgtcgcgctgcccttctaccgcaggagcccccagtga

DBGET integrated database retrieval system