KEGG   Actinoplanes missouriensis: AMIS_46740Help
Entry
AMIS_46740        CDS       T01795                                 

Definition
putative glycine cleavage system T protein
Orthology
K00605  
aminomethyltransferase [EC:2.1.2.10]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycine, serine and threonine metabolism
One carbon pool by folate
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_46740
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMIS_46740
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AMIS_46740
Enzymes [BR:ams01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     AMIS_46740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4899367..4900548)
Genome map
AA seq 393 aa AA seqDB search
MTERGRPQPVTTLEPPVRRTALFDVHTRLGAHLTTFAGWTMPLRYGSDIAEHHTVRTAAG
LFDLSHMGRIEVTGRNAAEFLDYALAGRLSTVKVGRAKYTMLCHTTGGVLDDLVVYRLAA
DRFLVVANAANAPMVRAMLGEHANGFAVRITDAGGSLIAVQGPASAEVIATQGPASAEVI
ATQGPASAKAMAIESLDLPYYGITEARVAGCDVLLARTGYTGEDGFEIYCSDADAATIWE
SLRESGATPAGLACRDTLRLEAGMPLYGHELTVRTTPFHAGLGRIVALDKADFVGAESLR
RVAAQGPSTVLTGLVTAGRRAPRSGHAVLDPVSGERIGEVTSGAPSPTLGHPIAMAYVPP
VFAAPGTRLVVDVRGTREDAEVVALPFYRRSPQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcgagggaggccccaacctgtcacgaccttggagcctcccgtgagacgcact
gcgctcttcgacgtccacacgcgcctcggcgcgcatctgaccacgttcgccggctggacc
atgccgctgcggtacggcagtgacatcgccgagcaccacaccgtgcggaccgccgcgggg
ctcttcgacctcagccacatgggccgcatcgaggtcaccggccgcaacgccgcggaattc
ctcgactacgccctcgccggccgtctctcgacggtcaaggtcggccgcgccaagtacacg
atgctctgccataccaccggcggcgtcctcgatgacctggtcgtctaccggctcgcggcc
gaccggttcctggtggtggcgaacgcggcgaacgccccgatggtccgggccatgctcggc
gagcacgccaacgggttcgcggtccggatcaccgacgccggcggctcgctgatcgcggtg
cagggccccgcatcggcggaagtgatcgccacgcagggccccgcatcggcggaagtgatc
gccacgcagggccccgcatcggcaaaagcgatggccatcgagagcctcgacctgccctat
tacggcatcaccgaggcgcgggtcgccggctgtgacgtgctgctggcccgcaccgggtac
accggcgaggacggcttcgagatctactgctcggacgccgacgccgcgaccatctgggag
agcctgcgggagagcggcgccacccccgccggtctggcctgccgggacacgctgcgcctg
gaggcgggcatgcccctgtacgggcacgagctcaccgtccgcaccacccccttccacgcc
gggctgggccggatcgtcgccctggacaaggcggacttcgtgggcgccgagtcgctgcgc
cgcgtcgccgcccaggggccgtcgaccgtgctgaccggcctggtcacggccggccgccgc
gcgccacgcagtggccatgcggtgctcgatccggtcagcggcgagcggatcggcgaggtg
accagtggcgcgccgtcgccgacgcttggtcacccgatcgccatggcctacgtcccaccc
gtgttcgcggcgcccggcacccgtctggtcgtcgacgtccgtggcacccgcgaggacgcc
gaggtcgtcgcgctgcccttctaccgcaggagcccccagtga

DBGET integrated database retrieval system