KEGG   Actinoplanes missouriensis: AMIS_50270Help
Entry
AMIS_50270        CDS       T01795                                 

Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ams  Actinoplanes missouriensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMIS_50270
Enzymes [BR:ams01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AMIS_50270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5329058..5329927
Genome map
AA seq 289 aa AA seqDB search
MSETSGVRVIGGRTYDFSRRVVVMAIVNRTPDSFHDRGRTFALEKATEAVQAAADDGADW
IDIGGVPFAPGPEVSAAEELERVLPVVEAARDRAVVSVDTFRPEVAREVIKEGAGVINDT
SGLRDPAMADAVAGTDAQLVITHSLAAPRTLHPRPEYGDVTAEVAAFLRERVELALSRGV
RPDQIIIDPGHDLNKNTLHSLAITRRLEEITSIGYPTLAALSNKDFIGETLGRPQHERLA
GTLATVVFCILHGARIMRVHDVRAAVDAVRMTEAMLGWREPAYLRHNMD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaacgagtggtgtgcgtgtgatcggcggccggacctacgacttctcccgccgc
gtcgtcgtgatggcgatcgtgaaccgcacgccggactcgttccacgatcgcggccgcacc
ttcgcgctggagaaggcgaccgaggccgtccaggcggcagccgacgacggcgctgactgg
atcgacatcggcggcgtcccgttcgccccgggccccgaggtgagcgccgcggaggaactg
gagcgggtcctcccggtcgtcgaagcggcccgcgaccgtgcggtggtctcggtggacacg
ttccgccccgaggtggcccgcgaagtgatcaaggaaggcgccggcgtcatcaacgacacc
tccggcctgcgggacccggcgatggccgacgcggtcgccggcaccgacgctcagctggtc
atcactcacagcctcgccgcgccgcgcacccttcatccccgccctgagtacggcgatgtg
accgccgaggtcgccgcgttcctgcgggagcgggtcgagctggcgctgtcccgcggggtg
cgcccggaccagatcatcatcgacccgggccacgacctcaacaagaacaccctgcactcg
cttgcgatcacccggcgtctcgaggagatcacctcgatcgggtacccgacgctcgcggcg
ctgagcaacaaggacttcatcggcgagaccctcggccggccgcagcacgagcggctggcc
ggcaccctggccacggtggtgttctgcatcctgcacggcgcccggatcatgcgggtgcac
gacgtgcgggcggcggtcgacgcggtgcggatgaccgaggcgatgctgggctggcgggaa
ccggcctacctgcgccacaacatggactga

DBGET integrated database retrieval system