KEGG   Actinoplanes missouriensis: AMIS_50610Help
Entry
AMIS_50610        CDS       T01795                                 

Definition
(GenBank) putative dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K16438  
5-epimerase [EC:5.1.3.-]
Organism
ams  Actinoplanes missouriensis
Pathway
Polyketide sugar unit biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Module
dTDP-L-megosamine biosynthesis
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AMIS_50610
   01055 Biosynthesis of vancomycin group antibiotics
    AMIS_50610
  Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    AMIS_50610
Enzymes [BR:ams01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-  
     AMIS_50610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5363739..5364332
Genome map
AA seq 197 aa AA seqDB search
MKARELAVAGAFAFTPEVFADDRGTFCSPLQEDSVAEVLGRPLFGVRQSSVSRSRRGVVR
GVHFTALPVSMAKYVFCTRGMALDYVIDLRRGSPTFGRTDVIPLDPENGTAVYLPSGVGH
LFVSLRDDTTMTYLLSAAYTADKERAVHPLDPELGLELPPGLVPVLSERDRTAPTLAQAR
ERDLLPAYRDCLLADAA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgcgcgagctcgccgtcgcgggcgccttcgcgttcacgccggaggtgttcgcc
gacgaccgcggcacgttctgctcgccgctgcaggaggactccgtggccgaggtgctgggc
cgcccgctcttcggagtccggcagtccagcgtcagccggtcccgtcgcggtgtcgtacgc
ggcgtgcacttcaccgccctgccggtgtcgatggcgaagtacgtgttctgcacgcgcggc
atggccctggattacgtcatcgacctgcggcgcggctccccgacgttcggccggacggac
gtcatcccgctggacccggagaacgggaccgccgtgtacctgccgtccggggtgggccac
ctgttcgtgtcgctgcgcgacgacaccacgatgacctacctgctgtcggcggcgtacacc
gccgacaaggagcgggcggtgcaccccctcgacccggagctgggcctggagctgccgccc
ggcctggtcccggtgctgtcggaacgggaccggaccgcgccgacgctggcgcaggctcgc
gagcgtgacctgctgccggcgtaccgggactgcctgctggcggacgcggcgtga

DBGET integrated database retrieval system