KEGG   Actinoplanes missouriensis: AMIS_50610Help
Entry
AMIS_50610        CDS       T01795                                 

Definition
(RefSeq) putative dTDP-4-dehydrorhamnose 3,5-epimerase
Organism
ams  Actinoplanes missouriensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5363739..5364332
Genome map
AA seq 197 aa AA seqDB search
MKARELAVAGAFAFTPEVFADDRGTFCSPLQEDSVAEVLGRPLFGVRQSSVSRSRRGVVR
GVHFTALPVSMAKYVFCTRGMALDYVIDLRRGSPTFGRTDVIPLDPENGTAVYLPSGVGH
LFVSLRDDTTMTYLLSAAYTADKERAVHPLDPELGLELPPGLVPVLSERDRTAPTLAQAR
ERDLLPAYRDCLLADAA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgcgcgagctcgccgtcgcgggcgccttcgcgttcacgccggaggtgttcgcc
gacgaccgcggcacgttctgctcgccgctgcaggaggactccgtggccgaggtgctgggc
cgcccgctcttcggagtccggcagtccagcgtcagccggtcccgtcgcggtgtcgtacgc
ggcgtgcacttcaccgccctgccggtgtcgatggcgaagtacgtgttctgcacgcgcggc
atggccctggattacgtcatcgacctgcggcgcggctccccgacgttcggccggacggac
gtcatcccgctggacccggagaacgggaccgccgtgtacctgccgtccggggtgggccac
ctgttcgtgtcgctgcgcgacgacaccacgatgacctacctgctgtcggcggcgtacacc
gccgacaaggagcgggcggtgcaccccctcgacccggagctgggcctggagctgccgccc
ggcctggtcccggtgctgtcggaacgggaccggaccgcgccgacgctggcgcaggctcgc
gagcgtgacctgctgccggcgtaccgggactgcctgctggcggacgcggcgtga

DBGET integrated database retrieval system