KEGG   Actinoplanes missouriensis: AMIS_52450Help
Entry
AMIS_52450        CDS       T01795                                 

Gene name
cheB3
Definition
putative response regulator receiver modulated methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ams  Actinoplanes missouriensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ams02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ams02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5568402..5569469
Genome map
AA seq 355 aa AA seqDB search
MIRVLIVEDSLTMRHHLREALAPDPELQVVGEAVDGERAVELAGRLRPDVITMDMMLPGI
SGLDATEHIMAEHPTPILVVSSADRQELFSTYNALAAGAVDVLEKPRGDDSDADWGQRLR
TTLRMVSRIRVITHPRARLGGRARPAPVAVTSASTAPAAAAALSVVAIGASTGGPGALTT
LIRELPPNFGTPVLVVQHIAASEQFAVAFSDWLAGQTGRNVRYATDGTPISRIGGQVLLA
PPDRHLYVRDKLLRLSDGPPRHSCRPAVDVLFESVAAEFGSTAAGCLLTGMGRDGAAGLL
QMRNRGAITFAQDEGSCVVYGMPREAALIGAAVHVLPPGRMAARLAELHPAVSRR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatccgggttctgatcgtcgaggactccctcaccatgcgccaccacctgcgggaggcg
ctcgccccggacccggagctgcaggtcgtcggcgaggcggtggacggcgagcgggccgtc
gagctggccggccggctgcgccccgacgtgatcacgatggacatgatgctgcccggcatc
agcgggctggatgccaccgagcacatcatggccgagcatccgacgccgatcctggtcgtc
tcgtcggcggaccggcaggagctgttcagcacgtacaacgcgctcgccgccggggcggtg
gacgtgctggagaagccgcgcggcgacgactcggacgcggactggggccagcggctgcgc
accaccctgcggatggtctcccggatccgggtgatcacccatccgcgggcccggctgggc
ggccgggcccggcccgcgccggtggcggtgacgtccgcgtccacggcgccggccgccgcg
gcggcgctcagcgtggtcgcgatcggcgcgtccaccggtggcccgggcgcgctcaccacg
ctgatccgcgagctgccgccgaacttcggcaccccggtcctggtggtgcagcacatcgcg
gcgagcgagcagttcgcggtggcgttctccgactggctcgccgggcagaccggccgcaac
gtgcgctacgcgaccgacggcaccccgatcagccggatcggcggccaggtgctgctcgct
cccccggaccgccacctgtacgtccgggacaaactgctgcggctcagcgacgggccgccc
cggcactcctgccggcccgccgtggacgtgctcttcgagtcggtggccgccgagttcggc
tcgaccgcggccggctgcctgctcaccgggatgggccgggacggcgcggccgggctgctg
cagatgcgcaaccggggcgcgatcacgttcgcccaggacgaggggagctgcgtcgtctac
ggcatgccgcgggaggcggcgctgatcggcgcggccgtgcacgtgctgccgccggggcgg
atggccgcccggctcgccgaactgcatccggcggtgtcccggcgatga

DBGET integrated database retrieval system