KEGG   Actinoplanes missouriensis: AMIS_52590Help
Entry
AMIS_52590        CDS       T01795                                 

Definition
putative isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ams  Actinoplanes missouriensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_52590
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AMIS_52590
Enzymes [BR:ams01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AMIS_52590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5585765..5587051
Genome map
AA seq 428 aa AA seqDB search
MTELTDNRGGTAEDLTREWASDPRWTGVKRDYTAQDVVKLRGTLQERHTLAERGAAKLWS
LLNTEDYINALGSLTGGQATQMVRAGLKAIYLSGWQVAADANLSGHTYPDQSLYPANSVP
AVVRRINNALLRADQIDTAAGRYERDWFAPIVADAEAGFGGPLNAFELMKAMIAAGAAGV
HWEDQLASEKKCGHLGGKVLIPTQQHIRTLNAARLAADVAGVPTLVIARTDALAADLLTT
DVDERDKPFLTGERTSEGFFRVRPGDDAAIARGVAYADYSDLLWVETGKPDLAFAKKFAE
AVHAKHPGKMLAYNCSPSFNWKKNLDDADIARFQKELGAMGYKFQFVTLAGFHALNHSMF
ELAKGYAETGMTAYVKLQEAEFAAETDGYTATKHQAEVGTGYFDAVSTALNPQSSTTALS
GSTEAEQF
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgactgagctgaccgacaaccgtggcggtaccgcagaggacctcactcgggaatgggcc
agtgatccccgctggaccggcgtcaagcgcgactacaccgctcaggacgtcgtgaagctg
cggggcaccctgcaggagcggcacaccctcgccgagcgcggcgccgcgaagctgtggagc
ctgctgaacaccgaggactacatcaacgccctcggctcgctgaccggcggccaggcgacc
cagatggtgcgcgccggcctgaaggcgatctacctctccggctggcaggtcgcggccgac
gcgaacctctccggccacacctacccggaccagtcgctctacccggcgaactcggttccc
gcggtggtccgccggatcaacaacgcgctgctgcgcgccgaccagatcgacaccgcggcc
ggccggtacgagcgtgactggttcgccccgatcgtcgccgacgcggaggccggcttcggt
ggcccgctcaacgcgttcgagctgatgaaggccatgatcgcggcgggcgcggcgggcgtg
cactgggaggaccagctggccagcgagaagaagtgcggccacctcggcggcaaggttctc
atccccacgcagcagcacatccgtaccctcaacgccgcccgtctcgcggcggacgtcgcc
ggcgtgcccaccctggtcatcgcccgcaccgacgcgctcgcggcggacctgctgaccacc
gatgtggacgagcgcgacaagccgttcctgaccggtgagcgcaccagcgagggcttcttc
cgggtgcgtcccggtgacgacgcggcgatcgcccgcggtgtcgcctacgccgactactcg
gacctgctctgggtggagaccggcaagcccgacctggcgttcgcgaagaagttcgccgag
gcggtgcacgccaagcacccgggcaagatgctggcctacaactgctcgccgtcgttcaac
tggaagaagaacctggacgacgccgacatcgcccgcttccagaaggagctcggcgcgatg
ggctacaagttccagttcgtcaccctcgccggcttccacgcgctcaaccactcgatgttc
gagctcgccaagggctacgccgagaccggcatgaccgcgtacgtgaagctgcaggaggcc
gagttcgcggccgagaccgacggctacaccgcgaccaagcaccaggccgaggtcggcacc
gggtacttcgacgccgtctccaccgcgctgaacccgcagagctccaccaccgccctgtcc
ggcagcaccgaggcggagcagttctga

DBGET integrated database retrieval system