KEGG   Actinoplanes missouriensis: AMIS_52600Help
Entry
AMIS_52600        CDS       T01795                                 

Definition
(RefSeq) putative malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ams  Actinoplanes missouriensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_52600
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMIS_52600
   00630 Glyoxylate and dicarboxylate metabolism
    AMIS_52600
Enzymes [BR:ams01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AMIS_52600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5587053..5588678
Genome map
AA seq 541 aa AA seqDB search
MGGEEVTITGTTDGRYSEILTPEAVAFIVALDREFGARRVQLLERRRRRRATRTTDLDFL
ISTRHIRDDLSWQVAPAAPDLTDRRVEITGPPERKMTINALNSGARVWMADFEDATAPTW
ENVVLGQANLRDALDGTLGFTAADGKKYEIGATMPTIMVRPRGWHLPECHLRIGGRAVSA
SLFDFGLYLYHCGQKQIDRGSGPYFYLPKMESHLEARLWNDVFLYASEYLGIPRGTIRAT
VLIETINAAFEMEEILYELREHSAGLNAGRWDYLFSMIKNRPDVVLPERSQVTMTAPFMR
AYTELLVRTCHKRGAHAIGGMAAVVPSRDPVAAKRALNQVRQDKRREVGDGFDGSWVAHP
GLVETCREVFDQWLGDEPHQIVRKREDVRVTAADLLDVRNSDVTVSEVALRTNASVALRY
IAAWLGGRGAVALGGLMEDAATAEICRAQLWQWISSGTLTDYGVPVTAALVTRMLREELD
VLSETGALDEDAARCFGQARTLLTVLLTERTCPEFLTLPAYLRHLSGGATAPVTTQAPVA
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgaagaggtcaccatcacgggcaccaccgacggccgctactccgagatcctc
acccccgaggccgtcgccttcatcgtggcgctggaccgcgagttcggcgcccgccgggtg
cagctgctggagcgccgccggcgccgccgggccacccggaccaccgacctggacttcctg
atctccacccggcacatccgggacgacctgtcctggcaggtcgccccggccgcgccggac
ctcaccgaccggcgggtcgagatcaccggcccgccggaacggaagatgaccatcaacgcg
ctgaactcgggcgctcgcgtgtggatggccgacttcgaggacgccaccgctcccacctgg
gagaacgtcgtcctcggccaggccaacctgcgcgacgcgctggacgggacgctgggcttc
acggcggccgacggcaagaagtacgagatcggcgcgacgatgccgacgatcatggtccgg
ccgcgcggctggcacctgcccgagtgtcacctgcggatcggcggccgggccgtctccgcg
tccctgttcgacttcggcctgtacctctaccactgcgggcagaagcagatcgaccggggc
agcgggccgtacttctacctgccgaagatggagtcgcacctggaggcccgcctctggaac
gacgtcttcctctacgcgagtgagtacctcggcatcccgcgcggcacgatccgggccacc
gtgctgatcgagacgatcaacgcggcgttcgagatggaagagatcctgtacgagctgcgc
gagcactcggccggcctgaacgcgggccgctgggactacctgttcagcatgatcaagaac
cgtccggacgtggtcctgcccgagcgttcccaggtcaccatgacggcgccgttcatgcgg
gcgtacaccgaactgctggtccgcacctgccacaagcgcggcgcccacgcgatcggcggg
atggccgcggtcgtcccgagccgtgacccggtcgccgcgaagcgggcgctgaaccaggtc
cgccaggacaagcgccgggaggtcggcgacggcttcgacggctcctgggtggcgcacccg
ggtctcgtcgagacctgccgcgaggtgttcgaccagtggctcggcgacgagccgcaccag
atcgtgcgcaagcgcgaggacgtgcgggtcaccgcggccgacctgctggacgtgcggaac
tcggacgtcaccgtcagcgaggtcgcgctgcggacgaacgcgagcgtcgcgctgcgctac
atcgcggcgtggctcggcggccgcggcgcggtcgctctcggcgggctcatggaggacgcc
gccaccgcggagatctgccgcgcgcagctctggcagtggatctcctcgggaacgctcacc
gactacggcgtgccggtcacggccgccctggtcaccagaatgctccgcgaggaactggac
gtgctcagcgagaccggcgcgctggacgaggacgcggcccggtgtttcggccaggcccgg
acgctgctgaccgtcctgctcaccgagcggacctgcccggagttcctcaccctgccggcc
tatcttcggcacctgtccggtggggcgacggctccggtcaccactcaggctcctgtcgcg
gcctga

DBGET integrated database retrieval system