KEGG   Actinoplanes missouriensis: AMIS_52810Help
Entry
AMIS_52810        CDS       T01795                                 

Definition
putative glycosyl hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ams  Actinoplanes missouriensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMIS_52810
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AMIS_52810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5609821..5611209
Genome map
AA seq 462 aa AA seqDB search
MKRRPKVLLAAALAVAAATATAFFALPAGAETATFTVTNSWNNGYQGQVTVGNDTSSAIS
TWKVELTLPAGTTVGQAWNATISSAGNTVTFTPAGWNATIAAGASTSFGFIANGSGRPTS
CLVNGKACTGVTTPSSPAASSPGASASPSASPSTPTSGTPVGVNGQLRVCGTKLCNESGS
AVQLKGMSTHGLQWFPSCYTDASLDVLANDWNADLFRISMYVQEGGYETNPSGFTAQVNN
LVEKATARGLYALVDFHILTPGDPNFNLERAKTFFREVSARHASKKNVIYEIANEPNGVS
WAQITSYAEQVIPIIRANDPDAVVVVGSRGWSSLGVSEGGSSSEIISNPVNASNVMYAFH
FYAASHQANYRAEVERAAASIPLFVTEFGTVSYTGDGAVDVASTNAWFDLLDRLKISYAN
WTYSDASEGSAAFRPGTCNAGSFAGTGSLTESGALLRNRIRA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcagaccgaaagtcctcctggccgcggcgctcgccgtggccgccgcgacggcc
accgcgttcttcgcgctgccggccggcgcggagaccgcgacgttcaccgtcacgaactcc
tggaacaacggttaccaaggtcaggtgacggtcggcaacgacacgtcgtcggcgatcagc
acctggaaggtcgagctgacgttaccggccggaaccaccgtgggccaggcctggaacgct
acgatcagctcggccgggaacaccgtgaccttcacgccggccggctggaacgcgacgatc
gcggccggggcctcgaccagtttcggcttcatcgccaacgggtccgggcgccccacgagc
tgcctcgtcaacgggaaggcgtgcaccggtgtgacaacaccctcgtcacccgccgcctca
tcacccggcgcgagcgcctcccccagcgcctcgcccagcacgcccacctcgggcaccccg
gtcggggtcaacgggcagctgcgcgtctgcggcaccaagctgtgcaacgagagcggcagc
gcggtccagctcaagggcatgagcacgcacggcctgcagtggttccccagctgctacacc
gacgcctcgctcgacgtcctcgcgaacgattggaacgccgacctcttccggatctccatg
tacgtccaggagggcggttacgagaccaacccgagcgggttcacggcgcaggtcaacaac
ctggtcgagaaggccacggcgcgcggcctctacgcgctcgtcgacttccacatcctcacg
ccgggtgacccgaacttcaacctggagcgggccaagacgttcttccgcgaggtgtccgcg
cggcacgcgtccaagaagaacgtgatctacgagatcgccaacgagccgaacggcgtgagc
tgggcgcagatcacgagctacgccgagcaggtcatcccgatcatccgggcgaacgacccg
gacgcggtcgtggtcgtcggcagccggggctggtcgtcgctgggcgtctccgagggcggg
tcgtcgtcggagatcatcagcaacccggtgaacgcgtcgaacgtgatgtacgcgttccac
ttctacgcggcgtcgcaccaggcgaactaccgcgccgaggtggagcgggccgccgcgtcg
atcccgctgttcgtcaccgagttcggcacggtcagctacaccggggacggcgcggtcgac
gtggccagcaccaacgcctggttcgacctgctggaccggttgaagatctcgtacgcgaac
tggacctactcggacgcgagcgagggcagcgccgcgttccgtccgggcacgtgcaacgcc
ggctcgttcgccgggaccggctcgctcaccgagtcgggcgcgctgctgcggaaccggatc
cgcgcgtag

DBGET integrated database retrieval system