KEGG   Actinoplanes missouriensis: AMIS_54220Help
Entry
AMIS_54220        CDS       T01795                                 

Gene name
cheR4
Definition
(GenBank) putative MCP methyltransferase CheR with PAS domain
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
ams  Actinoplanes missouriensis
Pathway
ams02020  Two-component system
ams02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ams00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMIS_54220 (cheR4)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AMIS_54220 (cheR4)
Enzymes [BR:ams01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     AMIS_54220 (cheR4)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AMIS_54220 (cheR4)
Two-component system [BR:ams02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AMIS_54220 (cheR4)
Bacterial motility proteins [BR:ams02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AMIS_54220 (cheR4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheR_N PAS_4 PAS PAS_9 PAS_8 PAS_10 PAS_7 Spc7 APG6 HMMR_N IncA WEMBL Reo_sigmaC DUF1664 MscS_porin DUF3584 Golgin_A5 Methyltransf_23 Exonuc_VII_L HOOK OmpH Methyltransf_12 KASH_CCD Methyltransf_31 Filament Fez1 DUF3450 IFT57 RasGAP_C APG17 Tropomyosin DUF4795 HemX TMPIT HAUS-augmin3 ADIP THOC7 DUF4686 AAA_23 CENP-F_leu_zip KxDL AAA_13 ZapB DUF4407 DUF812 Atg14 Methyltransf_25 HIP1_clath_bdg GAS DUF3540 Jnk-SapK_ap_N Syntaxin-6_N Mnd1 Seryl_tRNA_N CALCOCO1 RPW8 MCC-bdg_PDZ DASH_Duo1 V_ATPase_I LMBR1 DivIC DUF2959 ATG16 Laminin_II TPR_MLP1_2 DUF16 CENP-K MAP70 HAUS6_N HALZ FapA HAP1_N DUF3552 Bap31 DUF2203 Med30 Tropomyosin_1 bZIP_1
Motif
Other DBs
NCBI-ProteinID: BAL90642
UniProt: I0HCA5
Position
5762464..5764302
Genome map
AA seq 612 aa AA seqDB search
MQGIDPNFEALLAYLKESRGFDFTGYKRSSLMRRVSRRMGQVQARDYQEYLDYLQVHPDE
FTALFNTILINVTAFFRDADAWDYLRSDVLEPMIASRPADSTIRIWSAGCASGEEAYTLA
MALAEVVGLDQFRERVKIYATDVDAEQLNEARQAAYGKRDVQALPPELVEKYFEPINGRF
VFRKDLRRSVIFGRNDLVQDAPISRIDLLTCRNTLMYFNAGTQAKILGRFHFALADTGVL
FLGKAEMLLSHSSLFTPIDLKRRVFRRVPRLYAPPGVVFTDPPAVPAVGATGLDELRNEV
FASSPLAQLALTSDGMVALSNRQLENLFGVSSRDIGRPFRDLDLSYRPVELRRFIEQAQL
ERRTLRVSDVEFHRGTEVTYLELQISPLSGADGNLLGVNLIFHDVTSARRLQDDLEHANQ
QLEAAYEELQATNEELETTNEELQSTVEELETTNEELQSTNEELETTNEELQSTNDELQS
INDQLRISTSQLDEANVFLETVLTNLQAGVAVVDPDLRIRMWNRRAEDLWGLRSSEVIGQ
HFLNLDIGLPIDQLRPLLRGVLGPDGISAGTELDAVNRRGRAIMVRVACTPLSRPGGAPG
EGDGAIVVMETA
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagggatcgacccgaacttcgaggcgctgctcgcctacctcaaggagtcccggggt
ttcgacttcaccggctacaagcgctccagcctgatgcgccgggtgtcccgccggatgggg
caggtgcaggcgcgggactaccaggagtacctggactacctccaggtccatccggacgag
ttcaccgccctcttcaacaccatcctgatcaacgtgacggccttcttccgggatgccgac
gcctgggactatctgcgatccgacgtgctcgagccgatgatcgcgtcccggccggcggac
tccacgatccggatctggtcggccgggtgcgcctcaggcgaggaggcctacacgctcgcg
atggcgctcgccgaggtggtcgggctggaccagttccgggaacgcgtgaagatctacgcc
accgatgtggacgcggagcagctcaacgaggcgcggcaggcggcgtacggcaagcgcgac
gtgcaggccctgcccccggagctggtggagaagtacttcgagccgatcaacgggcggttc
gtcttccgcaaggacctgcggcgctcggtgatcttcgggcgcaacgacctggtgcaggac
gccccgatctcccggatcgacctgctcacctgccgcaacacgctgatgtacttcaacgcc
ggaacacaggcgaagatcctcggccggttccacttcgccctggccgacaccggcgtgctc
ttcctcggcaaggcggagatgctgctcagccactccagcctgttcacgccgatcgacctg
aaacgccgcgtctttcgccgggtgccccgcctctacgccccgcccggcgtggtcttcacc
gacccgccggcggtgccggccgtcggggccaccggcctggacgagctgcgcaacgaggtg
ttcgcgtccagcccgctggcacagctcgcgctcacctccgacggcatggtcgcgctctcc
aaccggcagctggagaacctgttcggcgtctcctcgcgggacatcggccggccgttccgc
gacctggacctgtcgtaccggccggtggagctgcggcgcttcatcgagcaggcgcagctg
gaacggcgcacgctgcgggtcagcgacgtcgaattccaccggggcaccgaggtcacctac
ctcgaattgcagatcagcccgctgagcggcgccgacggcaacctgctcggggtcaacctg
atcttccacgacgtgacgtcggctcgccgcctccaggacgatctggaacacgccaaccag
cagctcgaagcggcgtacgaggaactccaggcgaccaacgaggagctggagaccaccaac
gaggagctccagtcgacggtcgaggagctggagacgacgaacgaggagctccagtccacc
aacgaggagctggagaccaccaacgaggagctccagtccaccaacgacgagctgcagagc
atcaacgaccagctgcggatcagcaccagccagctggacgaggcgaacgtgttcctggag
accgtgctgaccaacctccaggccggcgtcgccgtggtcgacccggacctgcggatccgg
atgtggaaccggcgggccgaggacctgtgggggctgcgctccagcgaggtgatcggccag
cacttcctgaatctcgacatcggcctgccgatcgaccagctccggccgctgctgcgcggc
gtgctcggcccggacggcatctccgcgggcaccgaactcgacgcggtgaaccggcgtggc
cgggcgatcatggtgcgggtagcgtgcacgccgttgagccgtcccggcggcgctccgggc
gagggcgacggggccatcgtcgtgatggagaccgcctga

DBGET integrated database retrieval system