KEGG   Actinoplanes missouriensis: AMIS_54510Help
Entry
AMIS_54510        CDS       T01795                                 

Definition
(GenBank) putative polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00010  Glycolysis / Gluconeogenesis
ams00520  Amino sugar and nucleotide sugar metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01200  Carbon metabolism
Module
ams_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_54510
   00520 Amino sugar and nucleotide sugar metabolism
    AMIS_54510
Enzymes [BR:ams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AMIS_54510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAL90671
UniProt: I0HCD4
Position
5800578..5801381
Genome map
AA seq 267 aa AA seqDB search
MTILGIDIGGSGVKGAPVDTVRGELLAERFRVPTPQPATVESVVEAVAEVAERFGDFERV
GITFPGVVVDGVTRSAANVDKSWLDAPAAKLFTERLGKPATVLNDADAAGAAEVAFGAGR
DQSGLIMMVTLGTGIGSALFLDGVLIPNTELGHLEIDGKDAELLASDRIREQKELSWEHW
APRVEKYLRHVEMLLSPRLFVIGGGVSKKSEKFFPLIDIRTPMVAATLLNNAGIIGAAVS
AEQAAAGPGGQDPGAIQVDAAAQAAKS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcctcggcatcgacatcggcggctccggcgtgaaaggcgccccggtcgacacg
gtgcgcggtgagctgctcgctgagcggttccgcgtgcccaccccccagccggcgaccgtg
gagagcgtcgtggaagcggtggccgaggtcgccgagaggttcggcgacttcgagcgggtc
ggcatcaccttccccggcgtcgtcgtcgacggggtgacccgcagcgcggcgaacgtggac
aagtcgtggctcgacgcgcccgccgccaagctcttcaccgagcggctgggcaagccggcc
accgtgctcaacgacgcggacgcggcgggcgccgccgaggtggcgttcggcgcggggcgt
gaccagtccggcctgatcatgatggtcacgctgggcaccggcatcggcagcgcgctgttc
ctggacggcgtgctgatcccgaacaccgagctgggccacctggagatcgacggcaaggac
gcggagctgctcgcctcggaccggatccgggagcagaaggagctgtcctgggagcactgg
gcgccgcgggtggagaagtacctgcggcacgtcgagatgctgctctcgccccggctcttc
gtgatcggcggcggcgtgagcaagaagtcggagaagttcttcccgctgatcgacatccgg
accccgatggtcgcggccaccctgctgaacaacgccggcatcatcggcgcggcggtcagc
gccgagcaggccgcagccggtcccggcgggcaggaccccggtgcgatccaggtggatgcg
gcggcgcaggccgccaagagctga

DBGET integrated database retrieval system