KEGG   Actinoplanes missouriensis: AMIS_54510Help
Entry
AMIS_54510        CDS       T01795                                 

Definition
putative polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_54510
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_54510
   00520 Amino sugar and nucleotide sugar metabolism
    AMIS_54510
Enzymes [BR:ams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AMIS_54510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5800578..5801381
Genome map
AA seq 267 aa AA seqDB search
MTILGIDIGGSGVKGAPVDTVRGELLAERFRVPTPQPATVESVVEAVAEVAERFGDFERV
GITFPGVVVDGVTRSAANVDKSWLDAPAAKLFTERLGKPATVLNDADAAGAAEVAFGAGR
DQSGLIMMVTLGTGIGSALFLDGVLIPNTELGHLEIDGKDAELLASDRIREQKELSWEHW
APRVEKYLRHVEMLLSPRLFVIGGGVSKKSEKFFPLIDIRTPMVAATLLNNAGIIGAAVS
AEQAAAGPGGQDPGAIQVDAAAQAAKS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcctcggcatcgacatcggcggctccggcgtgaaaggcgccccggtcgacacg
gtgcgcggtgagctgctcgctgagcggttccgcgtgcccaccccccagccggcgaccgtg
gagagcgtcgtggaagcggtggccgaggtcgccgagaggttcggcgacttcgagcgggtc
ggcatcaccttccccggcgtcgtcgtcgacggggtgacccgcagcgcggcgaacgtggac
aagtcgtggctcgacgcgcccgccgccaagctcttcaccgagcggctgggcaagccggcc
accgtgctcaacgacgcggacgcggcgggcgccgccgaggtggcgttcggcgcggggcgt
gaccagtccggcctgatcatgatggtcacgctgggcaccggcatcggcagcgcgctgttc
ctggacggcgtgctgatcccgaacaccgagctgggccacctggagatcgacggcaaggac
gcggagctgctcgcctcggaccggatccgggagcagaaggagctgtcctgggagcactgg
gcgccgcgggtggagaagtacctgcggcacgtcgagatgctgctctcgccccggctcttc
gtgatcggcggcggcgtgagcaagaagtcggagaagttcttcccgctgatcgacatccgg
accccgatggtcgcggccaccctgctgaacaacgccggcatcatcggcgcggcggtcagc
gccgagcaggccgcagccggtcccggcgggcaggaccccggtgcgatccaggtggatgcg
gcggcgcaggccgccaagagctga

DBGET integrated database retrieval system