KEGG   Actinoplanes missouriensis: AMIS_54580Help
Entry
AMIS_54580        CDS       T01795                                 

Gene name
glgB
Definition
putative 1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ams  Actinoplanes missouriensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMIS_54580 (glgB)
Enzymes [BR:ams01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AMIS_54580 (glgB)
Exosome [BR:ams04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMIS_54580 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5808714..5810891
Genome map
AA seq 725 aa AA seqDB search
MTTPEDRTTMIGNTTSRLAADQRAMDSVISGATHDPHAILGAHPHGGHTVIRALRKGATT
VAVLHDGERTEMTAVHPDGIFAAELAGTVLDYRLDVDGTQCDDPYRHLPTLGELDLHLIG
EGRHEKLWKVLGAQPRGTGVAFAVWAPSAQGVQVIGDFSGWGPYDGWPMRSLGSSGVWEL
YVPSAHIGSKYKFKILGRDGVWREHADPVAQHTEVPPATASVVYQSSYSWHDEQWMRERA
RKSWHQEPISCYEVHLGSWRPGLTYTELAEQLVEYVLEIGFTHVELMPVMEHPFGGSWGY
QVTGYYAPTSRFGSPDEFRFLVDKLHQAGIGVILDWVPAHFPKDEWALARFDGTPLYEHG
DWRRGEQPDWGTYVFDFGRKEVRNFLVANALYWCEEFHADGLRVDAVASMLYLDYSRKDG
EWTPNQYGGRENLDAISFLQEMNATVYKHHPGVMTIAEESTAWPGVTRPTHLGGLGFGFK
WNMGWMNDTLSYIEKEPIYRQWHHHQMTFATVYAWSENYILPISHDEVVHGKGSLTGKMP
GDTWQKLANTRALLGFMWAFTGKQLLFMGAEMGDEKEWNESGGLHWDLLEDPQRAGVKTL
VSDLNRVYRESPALWSQDTNPAGFRWITSEDSQHNTFSFVRFTPNGDTLACIVNFAAVPH
EGYRIGLPRAGRWTEVINTDSEIYGGSGVGNMGAVEAEHVPWHGFDASAALRVPPLGALW
LRYEG
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccggaggacagaaccaccatgatcgggaacaccacctcgcgcctcgccgcc
gaccagcgcgccatggacagcgtgatctccggggcgacccacgatccgcacgccatcctc
ggcgcccacccgcacggcgggcacaccgtgatccgggccctgcgcaagggagcgacgacg
gtggcggtcctgcacgacggcgagcgcaccgagatgaccgcggtgcacccggacggcatc
ttcgcggccgagctggccggcaccgtgctggactaccggctggacgtggacgggacccag
tgcgacgacccgtaccggcacctgcccaccctcggtgagctggacctgcacctgatcggc
gagggccggcacgagaagctctggaaggtgctcggcgcgcagccgcgcggcaccggcgtg
gcgttcgcggtctgggcgccgagcgcgcagggcgtccaggtgatcggtgacttctccggc
tgggggccgtacgacgggtggccgatgcgctcgctcggctccagcggcgtctgggagctg
tacgtcccgagcgcgcacatcggctccaagtacaagttcaagatcctcggccgggacggg
gtgtggcgcgagcacgccgacccggtcgcccagcacaccgaggtgccgccggccaccgcg
tcggtggtctaccagtcgtcctactcctggcacgacgagcagtggatgcgcgagcgcgcc
cgcaagtcctggcaccaggagccgatcagctgctacgaggtgcacctgggctcgtggcgg
cccggcctgacctacaccgagctggccgagcagctggtggagtacgtgctggagatcggc
ttcacgcacgtcgagctgatgcccgtcatggaacacccgttcggcggctcgtggggttac
caggtcaccggctactacgcgccgacgtcgcgcttcggcagcccggatgaattccggttc
ttggtggataaattgcaccaggccggcatcggcgtgatcctcgactgggtgccggcgcac
ttcccgaaagacgagtgggcgctggcccgcttcgacggcaccccgctctacgagcacggc
gactggcggcgcggcgagcagccggactggggcacctacgtcttcgacttcggccgcaag
gaggtccgcaacttcctggtggcgaacgccctctactggtgcgaggagttccacgccgac
ggcctgcgggtcgacgcggtcgcctcgatgctctacctggactactcccgcaaggacggc
gagtggaccccgaaccagtacggcggccgggagaacctggacgcgatcagcttcctgcag
gagatgaacgcgaccgtctacaagcaccaccccggggtcatgacgatcgccgaggagtcc
accgcgtggccgggcgtcacccgccccacccacctgggcggcctcgggttcggcttcaag
tggaacatgggctggatgaacgacaccctctcgtacatcgagaaggagccgatctaccgg
cagtggcaccaccaccagatgacgttcgcgacggtctacgcgtggagcgagaactacatc
ctgccgatcagccacgacgaggtggtgcacggcaagggctcgctcaccggcaagatgccc
ggcgacacctggcagaagctggccaacacccgcgccctgctcggcttcatgtgggcgttc
accggcaagcagctgctcttcatgggcgccgagatgggcgacgagaaggagtggaacgag
agcggcggcctgcactgggacctgctcgaggacccgcagcgggccggcgtgaagacgctg
gtgagcgacctgaaccgggtctaccgtgagtcgcccgcgctgtggagccaggacaccaac
ccggccggcttccggtggatcaccagcgaggactcacagcacaacacgttctcgttcgtc
cgcttcacgccgaacggcgacaccctggcctgcatcgtcaacttcgccgcggtcccgcac
gagggctaccggatcggcctgccccgggccggccgctggaccgaggtgatcaacacggac
agtgagatctacggcggctccggcgtcggcaacatgggcgccgtggaggccgagcacgtg
ccgtggcacggcttcgacgcctcggccgcgctgcgcgtgccgccgctcggcgcgctctgg
ctgcgctacgagggctga

DBGET integrated database retrieval system