KEGG   Actinoplanes missouriensis: AMIS_56180Help
Entry
AMIS_56180        CDS       T01795                                 

Gene name
recD
Definition
putative exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ams  Actinoplanes missouriensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ams03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5997030..5999216
Genome map
AA seq 728 aa AA seqDB search
MVSKAPVSKSPHVLEAVLERLTYVNEETGYTVARVATGSGTDLLTVVGSLLGAQPGESLR
LSGWWSSHPQYGRQFEVISYTTVLPATIQGIRRYLGSGLVKGIGPVFAERIVDHFGLDTL
DVIEESPERLIEVPGLGPKRTAKITSAWAEQKAIKEVMVFLQGVGVSTSIAVRIYKKYGD
SSIAVVKNSPYKLASDVWGIGFKTADTIAQAVGIPHDSPERVKAGLQYTLSQATDNGHCF
LPADTLVSEAAKILDVPEGLVPSCLTSLVEEEGVVREDDAVYLVPFHRAEQSLASSLLRL
LSDNSDRLGQFAAVDWDKALAWLHQRTGQTLAPEQEQAVRLALTSKVAVLTGGPGCGKSF
TVRSIVELAAAKRAKIQLVAPTGRAAKRLAELTGHPAATVHRLLKLQPGGDASYDRDNPL
DADLLVVDEASMLDLILANKLVKAVPQGAHLLLVGDVDQLPSVGAGEVLRDLLAADAIPR
VRLTQIFRQAAQSGVVTNAHRVNQGRPPLLDGMTDFFLFPCDDTEATAALTVDVVCTRIG
RKFGLDPRRDVQVLAPMHRGPAGAGALNGLLQQQLTPGREGLPEKRLGGRVFRVGDKVTQ
IRNNYDKGAAGVFNGTVGVVTGLSPEEQTLTVRTDEDELIEYDFDELDELAHAYAITIHR
SQGSEYPAVVIPLTTSAWMMLQRNLLYTAITRAKKLVVLVGSRRALAAAVRTVSAGRRHT
ALTRRLGS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtccaaggcccccgtgtcgaagtccccccacgtcctggaagcggtcctcgagcgg
ctcacctacgtgaacgaggagaccggttacaccgtcgcccgggtcgccaccggctccggc
acggatctgctcaccgtggtcggatcgctgctcggcgcgcagcccggggagagcctgcgg
ctgagcggctggtggtcgtcgcacccgcagtacgggcggcagttcgaggtgatctcgtac
accaccgtgctgccggcgaccatccagggcatccgccgctacctcgggtcgggcctggtc
aagggcatcgggccggtcttcgccgagcggatcgtggaccacttcggactggacaccctg
gacgtgatcgaggagtcgccggagcggctgatcgaggtgcccggcctcggcccgaaacgc
accgcgaagatcacctcggcgtgggccgagcagaaggcgatcaaggaggtgatggtcttc
ctccagggcgtcggggtgtccacgtcgatcgccgtgcggatctacaagaagtacggcgac
tcgtccatcgcggtggtgaagaactcgccgtacaagctggcctcggacgtctggggcatc
ggcttcaagacggcggacacgatcgcgcaggccgtcgggatcccgcacgacagccccgag
cgggtgaaagccggcctgcagtacacgctgtcgcaggccaccgacaacgggcactgcttc
ctgccggcggacacgctggtgtcggaggccgcgaagatcttggacgttcccgagggcctc
gtcccgtcgtgtctcacctccctcgtcgaggaggagggggtggtccgcgaggacgacgcc
gtctatctggtgccgttccaccgggcggagcagtcgctggcgtcgtcgctgctccggctt
ctgtcggacaactccgacaggctggggcagttcgccgccgtcgattgggacaaggcgctc
gcctggctccatcagcgcaccgggcagacgctcgcccccgagcaggaacaggccgtccgg
ctcgcgctcacgtccaaggtcgcggtgctcaccggcggccccggatgcggcaagagcttc
acggtacggtcgatcgtcgagctcgccgccgcgaaacgcgccaagatccagctcgtcgct
ccgaccggccgggccgcgaaacggctcgccgagctgaccggccaccccgccgccaccgtc
caccgcctgctcaagctgcagcccggcggggacgccagttacgaccgggacaaccccctc
gacgccgacctgctcgtcgtcgacgaagccagcatgctcgacctgatcctggcgaacaag
ctggtcaaggccgtcccgcagggcgcgcacctgctgctggtcggcgacgtcgaccagctc
ccctcggtcggggccggcgaggtgctgcgcgacctgctcgccgccgacgcgatcccgcgc
gtccggctcacccagatcttccggcaggccgcgcagagcggcgtggtcaccaacgcgcac
cgggtcaaccagggccggccgccgctgctcgacggcatgaccgacttcttcctcttcccc
tgcgacgacaccgaagccaccgcggcgctcaccgtcgacgtggtctgcacccggatcggc
cgcaagttcggcctcgacccgcgccgtgacgtgcaggtgctcgccccgatgcaccgcggc
ccggccggcgcgggcgcgctcaacggcctgctccagcagcagctcacgccgggccgcgag
ggcctgccggagaaacggctcggcggccgggtgttccgggtcggcgacaaggtcacccag
atccggaacaactacgacaagggcgcggcaggcgtcttcaacggcaccgtgggcgtcgtg
accggactgtcccccgaggaacagaccctcaccgtccgcaccgacgaggacgagctcatc
gagtacgacttcgacgagctggacgagctggcacacgcctacgccatcacgatccaccgg
tcccagggctcggagtacccggccgtggtgatcccgctgaccaccagcgcctggatgatg
ctgcagcgcaacctcctctacaccgcgatcacccgcgccaagaagctggtcgtgctggtc
ggctcccgccgggccctggccgccgcggtccgcaccgtgagcgcggggcgccggcacacc
gccctgacccgccgcctcggctcatag

DBGET integrated database retrieval system