KEGG   Actinoplanes missouriensis: AMIS_57900Help
Entry
AMIS_57900        CDS       T01795                                 

Definition
putative PfkB-family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ams  Actinoplanes missouriensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMIS_57900
Enzymes [BR:ams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AMIS_57900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6196540..6197424
Genome map
AA seq 294 aa AA seqDB search
MNVVVTGQLARDLVLLVDEMPETGTSADARLRREMLGGKGANQAVALAQLGARPVLVAVR
GDDRVGEELIEQARRDGIDVGHVICRPGTETGLIVEALDASGGWRYLQHLPDGVLLTEAD
VDAAAPTLRSADAVLVQLQQPGPAALAAARHARAGGALVVLDGELPEAERDELLKLADVI
RADEHEAESLGDVSVEAPGGTGAETLGGTGGPLLMLGRSDGNLVRWADGEEFIPLTDEKV
VDTTGAGDALTAALTVGLLRGMPPVEAGRFAVAAAGATVGHPGGRPDLSRLRRG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgtcgtgaccggccagctggcccgagacctggtcctgctcgtggacgagatg
ccggagaccggcacctcggcggacgcccggctgcgccgggagatgctcggcggcaagggc
gccaatcaggccgtcgccctggcgcagctcggcgcgcggccggtgctggtcgcggtgcgc
ggcgacgaccgggtcggcgaggagctgatcgagcaggcccgccgggacgggatcgacgtc
ggtcacgtgatctgccggccgggcaccgagaccgggttgatcgtggaggcgctcgacgcg
tccggtggctggcgttacctgcagcacctgccggacggggtgctgctcaccgaggccgac
gtggacgcggcggcgcccacgctgcggtcggccgacgccgtcctggtgcagttgcagcag
cccggacccgccgcgctcgccgctgcccggcacgcccgcgcgggcggcgcgctggtggtc
ctggacggggagctgcccgaggccgagcgcgacgagctgctgaaactcgccgacgtgatc
cgcgccgacgagcacgaggccgagtccctcggcgacgtgagcgtcgaggcgccgggcggg
acgggagccgagacgctgggcgggacgggcggcccgctgctgatgctcgggcgctcggac
gggaacctggtccggtgggcggacggcgaggagttcatcccgctcaccgacgagaaggtg
gtggacaccacgggcgccggggacgcgctcaccgcggcgctaaccgtgggcctgctgcgg
gggatgcctccggtggaggccggccggttcgcggtggcggcggccggcgccacggtgggc
catccgggtggacgcccggatctctcccggctcaggcgggggtga

DBGET integrated database retrieval system