KEGG   Actinoplanes missouriensis: AMIS_58190Help
Entry
AMIS_58190        CDS       T01795                                 

Definition
putative alcohol dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ams  Actinoplanes missouriensis
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ams01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:ams00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ams00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6229062..6230390)
Genome map
AA seq 442 aa AA seqDB search
MRDPQLLTVLFRSRIEKHGGDSDVTNWRRTMSGNRAVVYQGPGRVEVCDVDYPSYEVKDG
PGVNKMNVGRRTPHGAILKTVASNICGSDQHMVRGRTTAPEGLVLGHEITGEVIDVGPDV
EFIRVGDVVSVPFNISCGRCRNCKERKTGVCLNVNPDRPGSAYGYVDMGGWVGGQAAYVM
VPYADWNLLRFPDRDQALEKALDLAMLSDIFPTGYHGCVSAGVTTGSTVYIAGAGPVGLA
AATSAFLLGAAVVIVGDLNDERLAQARSFGCETINVAQGDPTEQVQQILGRSAPAIGQPL
VDAAVDAVGFEARGHGRDSGTEMPATVLNSLMDLTRAGGAIGVPGLYVTGDPGGVDEAAK
VGSLSLRLGLGWAKSHSFVTGQCPVMKYNHGLMMAILHDRVQIAKNVNATPIPMDDAPRG
YQDFDQGAARKYVLDPHGVLRR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatccgcaactactgacggttctgttccggtcacgcatcgagaagcatggcggt
gacagcgacgtaaccaactggaggcgcaccatgtcaggcaacagagcggttgtctaccag
ggtcccggccgggtcgaggtctgcgacgtcgactacccgagctacgaggtgaaggacggc
cccggcgtcaacaagatgaacgtcgggcgcaggacaccccacggcgcgatcctcaagacg
gtcgccagcaacatctgcggcagcgaccagcacatggtccgcgggcgcaccaccgcgccg
gagggcctggtgctcggccacgagatcaccggcgaggtgatcgacgtcgggccggacgtc
gagttcatccgggtcggcgacgtggtctcggtgccgttcaacatctcctgcggcaggtgc
cgcaactgcaaggaacgcaagaccggcgtctgtctcaacgtgaacccggaccggcccggc
tcggcgtacggctacgtcgacatgggcggctgggtcggcggtcaggcggcgtacgtgatg
gttccctacgccgactggaacctgctccgcttcccggaccgcgaccaggccctggagaag
gccctggacctggcgatgctcagcgacatcttcccgaccgggtaccacggttgtgtgagc
gcgggcgtgacgaccgggtcgacggtctacatcgctggcgccggtccggtcggtctggcc
gctgcgacctcggcgttcctgctcggcgcggcggtcgtcatcgtcggtgacctcaacgac
gagcggctcgcgcaggcccgcagtttcggctgcgagacgatcaacgtggcgcagggtgat
ccgaccgagcaggtgcagcagatcctcggccgttccgcgccggcgatcggtcagccgctc
gtggacgccgcggtggacgccgtcggtttcgaggcccggggccacggccgcgactccggc
accgagatgcccgccaccgtgctgaactcgctgatggacctgacccgcgcgggcggcgcg
atcggcgtgcccggcctctacgtcaccggtgatccgggcggcgtcgacgaggccgccaag
gtcggctcgctctccctgcgactcggcctcggctgggcgaaatcgcactccttcgtgacc
ggtcagtgcccggtcatgaagtacaaccacgggctgatgatggcgatcctgcacgaccgg
gtgcagatcgcgaagaacgtcaacgccacaccgatcccgatggacgacgccccgcggggt
taccaggacttcgaccagggcgcggcgcgcaaatacgtgctcgacccgcacggcgtcctg
cgccgctag

DBGET integrated database retrieval system