KEGG   Actinoplanes missouriensis: AMIS_58950Help
Entry
AMIS_58950        CDS       T01795                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00010  Glycolysis / Gluconeogenesis
ams00071  Fatty acid degradation
ams00350  Tyrosine metabolism
ams00625  Chloroalkane and chloroalkene degradation
ams00626  Naphthalene degradation
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_58950
  Lipid metabolism
   00071 Fatty acid degradation
    AMIS_58950
  Amino acid metabolism
   00350 Tyrosine metabolism
    AMIS_58950
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMIS_58950
   00626 Naphthalene degradation
    AMIS_58950
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AMIS_58950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_31 CoA_binding Methyltransf_25 PCMT
Motif
Other DBs
NCBI-ProteinID: BAL91115
UniProt: I0HDM8
Position
6316540..6317550
Genome map
AA seq 336 aa AA seqDB search
MRAAVVTSFDQPLVVQEVPLPTPGEGQIRVRVEASGLCHTDIHAAQGDWPVKPNPPFIPG
HEGVGIVEELGAGVTQLAVGDRVAVPWLGYACGTCEYCVDGWETLCESQLNTGYAIDGGH
AEFLVADARYVVTVPEGIDPAEAAPLTCAGVTTYKAVKVGGVTPGDRVAIFGIGGLGHLA
QQYAQIFGGETIAVDVTEEKLALARDLGATHTVNAAETDPVAAIQALGGADVAVVLAASP
KVLEQAHASLRRGGRLVLVSLPKDNAMSLPIFETVLKGIRVIGSIVGTRKDLAEVFRLHA
AGRTRVLYETRKLDEINASIDDVLASRVPARLVLIP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcggtggtgaccagcttcgatcagcccctggtggtccaggaggtgcctttg
cccactccgggtgagggacagatccgggtacgggtcgaagcgagcggactctgccacacc
gatatccacgccgctcagggtgactggccggtgaagccgaaccctccgttcattcccggt
cacgagggcgtcggcatcgtcgaggagctcggcgccggcgtgacgcaactcgccgtgggt
gatcgggtcgccgtgccgtggctgggatacgcctgcggcacctgtgagtactgcgtcgac
ggctgggagacgctctgcgagtcgcagctgaacaccggttatgcgatcgacggcgggcac
gcggagttcctggtggccgacgcccgctacgtggtcacggttccggagggcatcgacccg
gccgaggcggcgccgctcacgtgcgccggggtcaccacgtacaaagcggtcaaggtcggt
ggcgtgacgccgggcgaccgggtcgcgatcttcgggatcggcggcctggggcacctggcg
cagcagtacgcgcagatcttcggcggggagacgatcgccgtcgacgtgaccgaggagaag
ctggctctggcccgcgacctgggcgcgacgcacacggtgaacgcggccgaaactgatccg
gtcgccgcgattcaggcgctgggtggcgcggacgtggcggtggtcctcgcggcgagcccg
aaggttctcgagcaggcgcacgcgtcgctgcggcgcggcggccggctggtgctggtgtcg
ctgccgaaggacaacgcgatgtcgctgccgatcttcgagacggtgctgaaggggatccgg
gtgatcgggtcgatcgtcggcacccgcaaggatctcgccgaggtgttccggctgcacgcc
gccgggcggacgagggtgctctacgagacccgcaagctcgacgagatcaacgcctcgatc
gacgacgttctcgcgagccgggtgccggcccgcctcgtcctcatcccctga

DBGET integrated database retrieval system