KEGG   Actinoplanes missouriensis: AMIS_60620Help
Entry
AMIS_60620        CDS       T01795                                 

Definition
(GenBank) putative fatty acid oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00071  Fatty acid degradation
ams00280  Valine, leucine and isoleucine degradation
ams00281  Geraniol degradation
ams00310  Lysine degradation
ams00362  Benzoate degradation
ams00380  Tryptophan metabolism
ams00410  beta-Alanine metabolism
ams00640  Propanoate metabolism
ams00650  Butanoate metabolism
ams00903  Limonene and pinene degradation
ams00930  Caprolactam degradation
ams01040  Biosynthesis of unsaturated fatty acids
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01200  Carbon metabolism
ams01212  Fatty acid metabolism
Module
ams_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMIS_60620
   00650 Butanoate metabolism
    AMIS_60620
  Lipid metabolism
   00071 Fatty acid degradation
    AMIS_60620
   01040 Biosynthesis of unsaturated fatty acids
    AMIS_60620
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMIS_60620
   00310 Lysine degradation
    AMIS_60620
   00380 Tryptophan metabolism
    AMIS_60620
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMIS_60620
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMIS_60620
   00281 Geraniol degradation
    AMIS_60620
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMIS_60620
   00930 Caprolactam degradation
    AMIS_60620
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AMIS_60620
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMIS_60620
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AMIS_60620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_Gly3P_dh_N NAD_binding_2 NAD_binding_8 F420_oxidored AlaDh_PNT_C DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAL91282
UniProt: I0HE45
Position
6514375..6516513
Genome map
AA seq 712 aa AA seqDB search
MTETIRWDQGEDGIVVLTLDDPARRANTMNDAYVRSMGQTVDRLYAERDSITGVIITSAK
KSWFAGGDLDQLGSVPADRGADVFALGTEVKGQLRRLETLGKPVVAAINGSALGGGLELA
LATHRRIALNNPRLEVGLPEVTLGLLPAGGGVVRTVRLLGLFVALTQVLLKGTRHRAPAA
KELGLIDELVDTPEQLLAAAREWILANPAAAQPWDTKGYRIPGGTPSTPALAAQLPAFPA
NLRKQLKGAPYPAPRNILSAAVEGAQVDVDTAFTIETRYFVELVTGTVAKNMIKAFFFDL
NEVTSRDIGDVPPIRKIAVLGAGMMGAAIAYVSAKSGVDVVLRDVSLEGAQRGKAYSEKL
VAKDVGRGRISQEKGQALLDRITATADVADLAGADVVIEAVFEDPALKHKVFAEIEGIVA
PDALLCSNTSTLPITLLAEGVRRQADFIGLHFFSPVDKMPLVEIIKGAQTSDLTVSRALG
VVRLLRKTPIVVNDSRGFFTSRVIGTFTNEGISMLAEGVPPASIEQASSQAGYPAPVLQL
MDELTLTLPRKIRKEYQAAAGDSYVPHPADGVIDRMIDEFERPGRSGGAGFYSYADGKRT
GLWEGLSAFATPAGREIPFEDLKERMLFIEAIETVKCLDEGVLTSVAEANVGSILGIGYP
GWTGGVLQYINQYAGGLPGFVARARELAERYGERFTPPPLLVSKASAGETFA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccatccgctgggatcagggtgaggacggcatcgtcgtgctcaccctcgac
gacccggcccgccgcgccaacaccatgaacgacgcgtacgtgcgcagcatgggccagacc
gtcgaccgcctctacgccgaacgcgacagcatcaccggcgtcatcatcacctcggccaag
aagtcctggttcgccggcggcgacctggaccagctcggcagcgtaccggccgaccgcggc
gcggacgtcttcgcgctcggcaccgaggtcaagggccagctgcgccggctcgagacgctc
ggcaagccggtggtggccgcgatcaacggctccgccctcggcggcggcctggagctggcg
ctggcgacccaccgccggatcgcgctgaacaacccgcgcctggaggtcggcctccccgag
gtcaccctgggactgctgccggccggtggcggcgtcgtgcgtaccgtgcggctcctgggt
ctgttcgtggccctcacccaggtgctgctcaagggcacccggcaccgcgcgccggccgcc
aaggagctgggcctgatcgacgagctggtggacaccccggagcagctgctcgccgcggcg
cgggagtggatcctggcgaacccggccgcagcccagccgtgggacaccaagggttaccgg
atcccgggtggcacgccgtccaccccggcgctcgccgcgcagctgccggccttcccggcg
aacctgcgcaagcagctcaagggcgcgccctacccggcgccgcgcaacatcctgtcggcc
gcggtcgagggcgcgcaggtcgacgtggacaccgcgttcaccatcgagacgcgctacttc
gtcgagctggtcaccggcacggtcgccaagaacatgatcaaggcgttcttcttcgacctg
aacgaggtcacctcccgcgacatcggcgacgtgccgccgatcaggaagatcgcggtgctc
ggcgccggcatgatgggcgccgcgatcgcctacgtgtccgcgaagtccggcgtggacgtg
gtgctccgggacgtctcgctggagggcgcccagcgcggtaaggcgtactcggagaagctc
gtcgccaaggacgtcggccggggccgcatcagccaggagaagggccaggccctgctcgac
cggatcaccgcgaccgccgacgtcgccgacctggccggcgcggacgtggtgatcgaggcg
gtcttcgaggacccggcgctcaagcacaaggtgttcgccgagatcgagggcatcgtggcg
ccggacgcgctgctctgctcgaacacctcgaccctgccgatcaccctgctcgccgagggt
gtgcgccgccaggcggacttcatcggcctgcacttcttctccccggtcgacaagatgccc
ctggtcgagatcatcaagggtgcgcagaccagcgatctcactgtcagtcgcgcgctcggc
gtggtgcggctgctgcgcaagacgccgatcgtggtcaacgacagccggggcttcttcacc
agccgggtgatcggcacgttcaccaacgagggcatctcgatgctcgccgagggtgtgccg
ccggccagcatcgagcaggccagcagccaggccgggtaccccgcgccggtgctgcagctg
atggacgagctcacgctgacgctgccccggaagatccgcaaggagtaccaggcggcggcc
ggcgactcctatgtcccgcaccccgccgatggcgtgatcgaccggatgatcgacgagttc
gagcgcccggggcggtccggcggcgcgggcttctactcctacgccgacggcaagcggacc
gggctgtgggagggactctccgccttcgccaccccggccggccgggagatcccgttcgag
gacctcaaggagcggatgctcttcatcgaggcgatcgagaccgtcaagtgcctggacgag
ggcgtgctgacctcggtggccgaggccaacgtcgggtccatcctcggcatcggctacccc
ggctggaccggcggcgtgctgcagtacatcaaccagtacgcgggcggccttcccggcttc
gtggcccgcgcccgggagctggccgagcgttacggtgagcggttcaccccgccgccgctg
ctggtctccaaggcctcggccggggagaccttcgcctga

DBGET integrated database retrieval system