KEGG   Actinoplanes missouriensis: AMIS_61160Help
Entry
AMIS_61160        CDS       T01795                                 

Definition
putative 1-phosphofructokinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
ams  Actinoplanes missouriensis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ams00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6575660..6576676)
Genome map
AA seq 338 aa AA seqDB search
MTGLDPGTVMTGLDPGTVMTGLNPGTVLTVTLNPSVDRALEVDALVRGEVLRAADSHIDP
GGKGVNVSRALLANGIRSTAVVPAGGAEGEQLVDLLKGEGVDMLAVPITGRTRSNITLAE
PDGTVTKINEAGPTLSDTEFAQVSDAVLAAAGTADWVVICGSLPPGPTVAAFTDLCERLV
KSGVRLAVDSSGPALLAGVAAGAALVKPNREELAEATGTDLVTLGDVIRACGRLREAGAG
TVLASLGAEGAVLVDAAGVITGVSPVSVPRSTVGAGDALLAGFLAAGASGEAALVEGLAW
GAAAVSLPGSRMPKPQDLDRTSIRLDREPDLNRPLRRD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcctggacccggggacggtcatgaccggcctggacccggggacggtcatgacc
ggcctgaacccggggacggtcctcaccgtcaccctgaatccgagcgtcgaccgtgccctc
gaggtcgacgcgctggtccggggcgaggtgttgcgggccgccgactcgcacatcgatccc
ggtggcaagggcgtgaacgtctcccgggcgctgctggcgaacgggatccgctcgacggcc
gtggtgccggccggtggcgccgagggcgagcagctcgtcgatctcctcaagggcgagggc
gtcgacatgctcgcggtgccgatcaccgggcggacccgttccaacatcaccctggccgag
ccggacggcacggtcacgaagatcaacgaagccggcccgaccctctcggacaccgagttc
gcccaggtcagtgatgcggtgctggcagccgccggcaccgccgactgggtggtgatctgc
ggcagcctcccgcccggcccgaccgtcgcggccttcaccgatctgtgtgagcggctggtc
aagtcgggtgtccggctcgccgtggacagcagtggcccggcgctgctggccggggtggcg
gcgggcgccgcgctggtcaagccgaaccgggaggagctggccgaggcgaccgggaccgac
ctggtgacgctcggcgacgtgatccgggcctgtgggcggctgcgcgaggccggcgcgggc
acggtccttgccagtctgggcgcggagggcgcggtgctggtggacgcggcgggggtgatc
accggtgtctcgccggtgagcgtgccgcgcagcactgtcggcgcgggggacgcgctgctg
gcgggcttcctcgcggccggcgcgagcggcgaggcggcgctggtggagggcctggcgtgg
ggcgcggccgcggtcagccttccgggcagccggatgccaaaaccacaagaccttgatcgt
acgagtatccggctcgaccgtgaaccggatttgaaccggccgctccgccgcgactga

DBGET integrated database retrieval system