KEGG   Actinoplanes missouriensis: AMIS_61160Help
Entry
AMIS_61160        CDS       T01795                                 

Definition
putative 1-phosphofructokinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
ams  Actinoplanes missouriensis
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AMIS_61160
Enzymes [BR:ams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     AMIS_61160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6575660..6576676)
Genome map
AA seq 338 aa AA seqDB search
MTGLDPGTVMTGLDPGTVMTGLNPGTVLTVTLNPSVDRALEVDALVRGEVLRAADSHIDP
GGKGVNVSRALLANGIRSTAVVPAGGAEGEQLVDLLKGEGVDMLAVPITGRTRSNITLAE
PDGTVTKINEAGPTLSDTEFAQVSDAVLAAAGTADWVVICGSLPPGPTVAAFTDLCERLV
KSGVRLAVDSSGPALLAGVAAGAALVKPNREELAEATGTDLVTLGDVIRACGRLREAGAG
TVLASLGAEGAVLVDAAGVITGVSPVSVPRSTVGAGDALLAGFLAAGASGEAALVEGLAW
GAAAVSLPGSRMPKPQDLDRTSIRLDREPDLNRPLRRD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcctggacccggggacggtcatgaccggcctggacccggggacggtcatgacc
ggcctgaacccggggacggtcctcaccgtcaccctgaatccgagcgtcgaccgtgccctc
gaggtcgacgcgctggtccggggcgaggtgttgcgggccgccgactcgcacatcgatccc
ggtggcaagggcgtgaacgtctcccgggcgctgctggcgaacgggatccgctcgacggcc
gtggtgccggccggtggcgccgagggcgagcagctcgtcgatctcctcaagggcgagggc
gtcgacatgctcgcggtgccgatcaccgggcggacccgttccaacatcaccctggccgag
ccggacggcacggtcacgaagatcaacgaagccggcccgaccctctcggacaccgagttc
gcccaggtcagtgatgcggtgctggcagccgccggcaccgccgactgggtggtgatctgc
ggcagcctcccgcccggcccgaccgtcgcggccttcaccgatctgtgtgagcggctggtc
aagtcgggtgtccggctcgccgtggacagcagtggcccggcgctgctggccggggtggcg
gcgggcgccgcgctggtcaagccgaaccgggaggagctggccgaggcgaccgggaccgac
ctggtgacgctcggcgacgtgatccgggcctgtgggcggctgcgcgaggccggcgcgggc
acggtccttgccagtctgggcgcggagggcgcggtgctggtggacgcggcgggggtgatc
accggtgtctcgccggtgagcgtgccgcgcagcactgtcggcgcgggggacgcgctgctg
gcgggcttcctcgcggccggcgcgagcggcgaggcggcgctggtggagggcctggcgtgg
ggcgcggccgcggtcagccttccgggcagccggatgccaaaaccacaagaccttgatcgt
acgagtatccggctcgaccgtgaaccggatttgaaccggccgctccgccgcgactga

DBGET integrated database retrieval system