KEGG   Actinoplanes missouriensis: AMIS_61220Help
Entry
AMIS_61220        CDS       T01795                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ams  Actinoplanes missouriensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ams00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6580661..6581710
Genome map
AA seq 349 aa AA seqDB search
MTRYGPMFGPDYTFLGVPACDWETPETYADADVVIIGAPFDGGTSHRPGARFGPQVIRGT
DYLPHDGSRPHMAMRVDALTGDLTVKDAGDLEVFSGEIQRSCTTIEDAVAFISSHGAIPL
ILGGDHTITWPDATGVSRTHGKGRIALIHFDAHADTGDIEFGSLYGHGQPMRRLIESGAV
RGDRFLQLGLRGYWPGPETLDWMADQRMNSFHMSEIVERGLDAVLDSAFAIAMDDCDGVF
LSVDIDVCDPGHAPGTGTPEPGGLTARQLLDAVSRICHELPVVGMDIVEVSPPFDHAEIT
AMLGNRVVLEALSGIARRRKDGDGPRWKRSTPLLEGRGTGAQQPGEAVG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacccgctacggaccgatgttcgggccggactacacgttcctcggtgttccggcctgt
gactgggagacaccggagacctatgccgacgccgacgtcgtgatcatcggcgcgcccttc
gacggcggcacctcgcaccggccgggcgcccggttcggaccacaggtgatccgcggcacc
gactacctgccgcacgacggctcacgcccgcacatggcgatgcgggtcgacgcgctcacc
ggcgacctgaccgtgaaggacgccggcgacctggaggtcttcagcggtgagatccagcgc
agctgcacgacgatcgaggacgctgtcgcgttcatctcctcccacggcgcgatcccgctg
atcctcggcggggaccacaccatcacctggccggacgccacgggcgtgtcccgcacgcac
ggcaagggccggatcgcgctgatccacttcgacgcgcacgccgacaccggggacatcgag
ttcgggtcgctctacggccacggccagccgatgcgccggctgatcgagtccggggcggtc
cgcggggaccggttcctgcagctcggcctccgcgggtactggccgggcccggagacgctc
gactggatggccgaccagcggatgaactcgttccacatgagcgagatcgtcgagcgcggc
ctggacgcggtgctggacagcgcgttcgcgatcgcgatggacgactgcgacggcgtcttc
ctctcggtcgacatcgacgtctgcgaccccggccacgcgcccggcaccggcacccccgag
cccggcggcctcaccgcccgccagttgctcgacgcggtctcccggatctgccatgagctg
ccggtcgtcggcatggacatcgtggaggtgtcgccgccgttcgaccacgccgagatcacc
gcgatgctcggcaaccgggtggtgctcgaagcgctctccgggatcgcccggcggcgcaag
gacggcgacgggccgcggtggaagcggtccactcccctgctagagggccggggcacgggg
gcccagcagccgggtgaggccgtcggctag

DBGET integrated database retrieval system