KEGG   Actinoplanes missouriensis: AMIS_62470Help
Entry
AMIS_62470        CDS       T01795                                 

Definition
(GenBank) putative beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00511  Other glycan degradation
ams00520  Amino sugar and nucleotide sugar metabolism
ams01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMIS_62470
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AMIS_62470
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AMIS_62470
Chaperones and folding catalysts [BR:ams03110]
 Intramolecular chaperones
  Others
   AMIS_62470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b RuvB_N
Motif
Other DBs
NCBI-ProteinID: BAL91467
UniProt: I0HEN0
Position
complement(6717208..6718683)
Genome map
AA seq 491 aa AA seqDB search
MIPRPHSVRPEQGHLSISDGGIRVREDAALPREGYVLDTTGDVAELRGGSAAGLHYGRQT
LDRLATPGSPLAPGARDSSPAPGARDSSLVPRVRIEDAPRFEWRGVLLDVARHFMPVPDV
LKFVDLLAFHRLNVLHLHLTDDQGWRFEVPGWPRLTSVGAWRDESMLGARVHERYDGRPH
GGFYTTDDLRRIVAYAAQRHITVVPEVDMPGHMQAAIAAYPELGNGFRGGVRTAWGISTH
VLNLEPATLDFCRQVLDHVCDVFDSPVIGIGGDECPADEWPGGRELQVAFTAEMAAHLDR
RGRRLYGWDEILAGGAPPGAVVAAWRGEEPAEVAIRAGHQVVCCPDVRLYLDYRQSDDPG
EPTPVGTLLTLEDVYRYEPPDSPLVLGAQANLWTEHMESLRRVEYMAFPRLCAFAEVVWG
PKERDLADFLARLPEHLSRLDAMGVNYRPLSGPRPADARPDAPGNPRTLADRLAELHEMT
ADLRGPGDSGP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
ttgattccccgaccccattcggtacggccggagcagggtcacctgtcgatcagcgacggc
ggcatccgggtccgagaggatgcggcgcttccccgtgagggctacgtgctggacaccacc
ggtgacgtcgccgagctgcgcggcggctcggcggccggcctccactacggccggcagacg
ctggaccggctggcgacgcccggctcgccgctggcccctggggcgcgggactcgtcgccg
gcccccggggcgcgggactcgtcgcttgtcccgcgcgtgcgcatcgaggacgcgccgcgc
ttcgagtggcgcggggtgctgctcgatgtggcgcgacacttcatgcccgtacccgatgtg
ctgaagttcgtcgatcttctggcgttccaccggctgaacgtcctgcacctgcatctcacc
gacgaccagggctggcgcttcgaggtgccgggatggccgcggctcacgtcggtcggcgca
tggcgggacgagtcgatgctcggcgcgcgggtccacgagcggtacgacgggcgcccgcac
ggcggcttctacaccacggacgatctgcggcggatcgtggcgtacgcggcccagcggcac
atcaccgtggtgcccgaggtggacatgccggggcacatgcaggcggcgatcgccgcgtac
ccggaactgggcaacggattccgcggcggcgtccggaccgcctggggcatctccacgcac
gtgctcaacctggaaccggccaccctggacttctgccggcaggtgctcgaccacgtctgc
gacgtcttcgactccccggtgatcgggatcggcggcgacgagtgcccggccgacgaatgg
cccggcggacgggaactgcaggtcgcgttcaccgccgagatggccgcgcacctggaccgg
cgcggccgccgcctctacggctgggacgagatcctggccggtggcgcgccgcccggcgcg
gtcgtcgcggcgtggcgcggcgaggagccggccgaggtcgccatccgggccggtcaccag
gtggtctgctgcccggacgtgcggctctacctcgactaccgccagtcggacgaccccggc
gagcccaccccggtgggcacgctgctcacgctcgaggacgtctaccgctacgagccgccg
gactcgccgctcgtgctcggcgcgcaggcgaacctctggaccgagcacatggagtcgctg
cgccgcgtggagtacatggcgttcccccggctctgcgcgttcgccgaggtcgtctggggt
ccgaaggagcgcgacctcgccgacttcctggcccggctgcccgagcacctgagccggctc
gacgcgatgggcgtcaactaccggccgctgagcggcccgcgcccggccgacgcgcggccg
gacgccccgggcaacccgcggaccctcgccgaccggctcgccgagctgcacgagatgacc
gctgacctgcgaggccccggcgattccggaccttag

DBGET integrated database retrieval system