KEGG   Actinoplanes missouriensis: AMIS_63770Help
Entry
AMIS_63770        CDS       T01795                                 

Definition
(GenBank) putative malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00620  Pyruvate metabolism
ams00630  Glyoxylate and dicarboxylate metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01200  Carbon metabolism
Module
ams_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMIS_63770
   00630 Glyoxylate and dicarboxylate metabolism
    AMIS_63770
Enzymes [BR:ams01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AMIS_63770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI TPR_16 TPR_12 YdaS_antitoxin
Motif
Other DBs
NCBI-ProteinID: BAL91597
UniProt: I0HF10
Position
complement(6849119..6850666)
Genome map
AA seq 515 aa AA seqDB search
MTEILSDEAVAFVADLNRRFRPRRNELLEARARRRAEIAAGASLGFLAETADIRAAEWTA
PPAPADLQDRRVEITGPTERKMTINALNSGAKVWLADLEDANTPHWSNVVDGQQNLYDAI
RRTIRLETDKKNYELNGGPYPTIVMRPRGWHLDERHLPVDGAPAVGALVDFGLYFFHNAA
ELLSRGSGPYFYLPKMESHKEAELWNDVFTYAQEKLGIPVGTIRATVLIETIPAAFEMEE
ILYALRPHISGLNAGRWDYLFSIIKYFRDNPTMILPDRAAVTMTAPFMRAYSELLVSTCH
RRGAFAMGGMAAFIPSRRDPEVNKVALAKVREDKEREAGDGFDGSWVAHPDLVPVCAEIF
DRVLGDKPNQLGKQRPDVAVDAHDLLNVAALTAPVTAAGLRNNVNVALQYLEAWLRGNGA
VGIHNLMEDAATAEISRSQVWQWIHNGVRLEDGTLITAELVGRIEDEELAAIRESIGDEA
WTAGRYDDARKLFERVALAGDFADFLTSAAYDAID
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcctgtccgacgaggccgtggcgttcgtcgccgacctgaaccggcgattc
cggcctcgccgtaacgagcttctcgaggcccgtgcccgccgccgcgcagagatcgcggca
ggggcgagcctcggcttcctcgcggagacggcggacatccgtgccgccgagtggacggcg
ccgcccgcgccggccgatctccaggaccgccgcgtcgagatcaccgggccgaccgagcgc
aagatgaccatcaacgcgctgaactcgggcgccaaggtgtggctcgcggacctggaggac
gccaacactccacactggtccaacgtggtggacgggcagcagaatctgtacgacgcgatc
cggcggacgatccggttggaaaccgataagaagaactacgagctcaacggcggcccctac
ccgaccatcgtgatgcgcccccgcggctggcacctcgacgagcgccacctcccggtcgac
ggggcacctgctgtcggcgccctcgtcgacttcgggctctacttcttccacaacgccgct
gagctgctgtcacgtggcagcgggccgtacttctacctgccgaagatggagtcgcacaag
gaggcggagctctggaacgacgtcttcacgtacgcccaggagaagctcggcatcccggtc
ggcaccatccgcgccaccgtgctgatcgagacgatcccggcggcgttcgagatggaggag
atcctctacgcgctccggccgcacatctccggcctcaacgcggggcgctgggactacctg
ttcagcatcatcaagtacttccgtgacaacccgaccatgatcctgccggaccgggccgcc
gtcacgatgaccgcgccgttcatgcgcgcctactccgagctgctcgtctccacctgccac
cggcggggcgcgttcgcgatgggcggcatggccgcgttcatcccgagccgccgcgacccg
gaggtcaacaaggtggcgctcgcgaaggtccgcgaggacaaggaacgtgaggccggcgac
ggcttcgacggctcctgggtcgcccaccccgacctggtgccggtctgcgcggagatcttc
gaccgggtgctcggcgacaagccgaaccagctcggcaagcagcgcccggacgtcgccgtc
gacgcgcacgacctgctcaacgtcgccgccctgacggccccggtcaccgcggccggcctg
cgcaacaacgtcaacgtcgcgctgcagtacctggaggcctggctgcgcggcaacggcgcg
gtcggcatccacaacctgatggaggacgcggccaccgctgagatctcgcgctcacaggtg
tggcagtggatccacaacggggtacggctcgaggacggcacgctgatcaccgcggagctg
gtcggccggatcgaggacgaggagctcgccgcgatccgtgagtcgatcggggacgaggcg
tggacggcgggccgctacgacgacgctcgcaagctgttcgaacgggtcgccctcgccggc
gacttcgccgacttcctgacgagcgccgcgtacgacgcgatcgactga

DBGET integrated database retrieval system