KEGG   Actinoplanes missouriensis: AMIS_63770Help
Entry
AMIS_63770        CDS       T01795                                 

Definition
putative malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ams  Actinoplanes missouriensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_63770
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMIS_63770
   00630 Glyoxylate and dicarboxylate metabolism
    AMIS_63770
Enzymes [BR:ams01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AMIS_63770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6849119..6850666)
Genome map
AA seq 515 aa AA seqDB search
MTEILSDEAVAFVADLNRRFRPRRNELLEARARRRAEIAAGASLGFLAETADIRAAEWTA
PPAPADLQDRRVEITGPTERKMTINALNSGAKVWLADLEDANTPHWSNVVDGQQNLYDAI
RRTIRLETDKKNYELNGGPYPTIVMRPRGWHLDERHLPVDGAPAVGALVDFGLYFFHNAA
ELLSRGSGPYFYLPKMESHKEAELWNDVFTYAQEKLGIPVGTIRATVLIETIPAAFEMEE
ILYALRPHISGLNAGRWDYLFSIIKYFRDNPTMILPDRAAVTMTAPFMRAYSELLVSTCH
RRGAFAMGGMAAFIPSRRDPEVNKVALAKVREDKEREAGDGFDGSWVAHPDLVPVCAEIF
DRVLGDKPNQLGKQRPDVAVDAHDLLNVAALTAPVTAAGLRNNVNVALQYLEAWLRGNGA
VGIHNLMEDAATAEISRSQVWQWIHNGVRLEDGTLITAELVGRIEDEELAAIRESIGDEA
WTAGRYDDARKLFERVALAGDFADFLTSAAYDAID
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcctgtccgacgaggccgtggcgttcgtcgccgacctgaaccggcgattc
cggcctcgccgtaacgagcttctcgaggcccgtgcccgccgccgcgcagagatcgcggca
ggggcgagcctcggcttcctcgcggagacggcggacatccgtgccgccgagtggacggcg
ccgcccgcgccggccgatctccaggaccgccgcgtcgagatcaccgggccgaccgagcgc
aagatgaccatcaacgcgctgaactcgggcgccaaggtgtggctcgcggacctggaggac
gccaacactccacactggtccaacgtggtggacgggcagcagaatctgtacgacgcgatc
cggcggacgatccggttggaaaccgataagaagaactacgagctcaacggcggcccctac
ccgaccatcgtgatgcgcccccgcggctggcacctcgacgagcgccacctcccggtcgac
ggggcacctgctgtcggcgccctcgtcgacttcgggctctacttcttccacaacgccgct
gagctgctgtcacgtggcagcgggccgtacttctacctgccgaagatggagtcgcacaag
gaggcggagctctggaacgacgtcttcacgtacgcccaggagaagctcggcatcccggtc
ggcaccatccgcgccaccgtgctgatcgagacgatcccggcggcgttcgagatggaggag
atcctctacgcgctccggccgcacatctccggcctcaacgcggggcgctgggactacctg
ttcagcatcatcaagtacttccgtgacaacccgaccatgatcctgccggaccgggccgcc
gtcacgatgaccgcgccgttcatgcgcgcctactccgagctgctcgtctccacctgccac
cggcggggcgcgttcgcgatgggcggcatggccgcgttcatcccgagccgccgcgacccg
gaggtcaacaaggtggcgctcgcgaaggtccgcgaggacaaggaacgtgaggccggcgac
ggcttcgacggctcctgggtcgcccaccccgacctggtgccggtctgcgcggagatcttc
gaccgggtgctcggcgacaagccgaaccagctcggcaagcagcgcccggacgtcgccgtc
gacgcgcacgacctgctcaacgtcgccgccctgacggccccggtcaccgcggccggcctg
cgcaacaacgtcaacgtcgcgctgcagtacctggaggcctggctgcgcggcaacggcgcg
gtcggcatccacaacctgatggaggacgcggccaccgctgagatctcgcgctcacaggtg
tggcagtggatccacaacggggtacggctcgaggacggcacgctgatcaccgcggagctg
gtcggccggatcgaggacgaggagctcgccgcgatccgtgagtcgatcggggacgaggcg
tggacggcgggccgctacgacgacgctcgcaagctgttcgaacgggtcgccctcgccggc
gacttcgccgacttcctgacgagcgccgcgtacgacgcgatcgactga

DBGET integrated database retrieval system