KEGG   Actinoplanes missouriensis: AMIS_63770Help
Entry
AMIS_63770        CDS       T01795                                 

Definition
putative malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ams  Actinoplanes missouriensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_63770
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMIS_63770
   00630 Glyoxylate and dicarboxylate metabolism
    AMIS_63770
Enzymes [BR:ams01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AMIS_63770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6849119..6850666)
Genome map
AA seq 515 aa AA seqDB search
MTEILSDEAVAFVADLNRRFRPRRNELLEARARRRAEIAAGASLGFLAETADIRAAEWTA
PPAPADLQDRRVEITGPTERKMTINALNSGAKVWLADLEDANTPHWSNVVDGQQNLYDAI
RRTIRLETDKKNYELNGGPYPTIVMRPRGWHLDERHLPVDGAPAVGALVDFGLYFFHNAA
ELLSRGSGPYFYLPKMESHKEAELWNDVFTYAQEKLGIPVGTIRATVLIETIPAAFEMEE
ILYALRPHISGLNAGRWDYLFSIIKYFRDNPTMILPDRAAVTMTAPFMRAYSELLVSTCH
RRGAFAMGGMAAFIPSRRDPEVNKVALAKVREDKEREAGDGFDGSWVAHPDLVPVCAEIF
DRVLGDKPNQLGKQRPDVAVDAHDLLNVAALTAPVTAAGLRNNVNVALQYLEAWLRGNGA
VGIHNLMEDAATAEISRSQVWQWIHNGVRLEDGTLITAELVGRIEDEELAAIRESIGDEA
WTAGRYDDARKLFERVALAGDFADFLTSAAYDAID
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcctgtccgacgaggccgtggcgttcgtcgccgacctgaaccggcgattc
cggcctcgccgtaacgagcttctcgaggcccgtgcccgccgccgcgcagagatcgcggca
ggggcgagcctcggcttcctcgcggagacggcggacatccgtgccgccgagtggacggcg
ccgcccgcgccggccgatctccaggaccgccgcgtcgagatcaccgggccgaccgagcgc
aagatgaccatcaacgcgctgaactcgggcgccaaggtgtggctcgcggacctggaggac
gccaacactccacactggtccaacgtggtggacgggcagcagaatctgtacgacgcgatc
cggcggacgatccggttggaaaccgataagaagaactacgagctcaacggcggcccctac
ccgaccatcgtgatgcgcccccgcggctggcacctcgacgagcgccacctcccggtcgac
ggggcacctgctgtcggcgccctcgtcgacttcgggctctacttcttccacaacgccgct
gagctgctgtcacgtggcagcgggccgtacttctacctgccgaagatggagtcgcacaag
gaggcggagctctggaacgacgtcttcacgtacgcccaggagaagctcggcatcccggtc
ggcaccatccgcgccaccgtgctgatcgagacgatcccggcggcgttcgagatggaggag
atcctctacgcgctccggccgcacatctccggcctcaacgcggggcgctgggactacctg
ttcagcatcatcaagtacttccgtgacaacccgaccatgatcctgccggaccgggccgcc
gtcacgatgaccgcgccgttcatgcgcgcctactccgagctgctcgtctccacctgccac
cggcggggcgcgttcgcgatgggcggcatggccgcgttcatcccgagccgccgcgacccg
gaggtcaacaaggtggcgctcgcgaaggtccgcgaggacaaggaacgtgaggccggcgac
ggcttcgacggctcctgggtcgcccaccccgacctggtgccggtctgcgcggagatcttc
gaccgggtgctcggcgacaagccgaaccagctcggcaagcagcgcccggacgtcgccgtc
gacgcgcacgacctgctcaacgtcgccgccctgacggccccggtcaccgcggccggcctg
cgcaacaacgtcaacgtcgcgctgcagtacctggaggcctggctgcgcggcaacggcgcg
gtcggcatccacaacctgatggaggacgcggccaccgctgagatctcgcgctcacaggtg
tggcagtggatccacaacggggtacggctcgaggacggcacgctgatcaccgcggagctg
gtcggccggatcgaggacgaggagctcgccgcgatccgtgagtcgatcggggacgaggcg
tggacggcgggccgctacgacgacgctcgcaagctgttcgaacgggtcgccctcgccggc
gacttcgccgacttcctgacgagcgccgcgtacgacgcgatcgactga

DBGET integrated database retrieval system