KEGG   Actinoplanes missouriensis: AMIS_63920Help
Entry
AMIS_63920        CDS       T01795                                 

Definition
putative glycosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ams  Actinoplanes missouriensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMIS_63920
Enzymes [BR:ams01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AMIS_63920
Glycosyltransferases [BR:ams01003]
 Polysaccharide
  Storage polysaccharide
   AMIS_63920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6870406..6871647
Genome map
AA seq 413 aa AA seqDB search
MKILMLSWEYPPLLVGGLGRHVHALATTLVAAGHDVTVVTRHTPGALTEEYTEGVRVVRA
PDDPPTATGADDDMLGWAMAFNHTLTRAALRASRTERYDVVHAHDWLVAHAAVTLRDHLD
VPLVATVHATESGRHQGWLPAPANRAIDGIERWLCAEAVRVIVCSAYMKREVIRLFDVPP
SRAEVVFNGVDALRWRARPRAVEAARARYAGDGPLISFAGRLVYEKGVQHLMAAVPMLRE
RHPGLRVVIAGDGPYRKDLEDLAGSLGVSFAGFLGGHELTALMGASDCYVVPSIYEPFGM
VALEAAAAGTPVAVAGTGGLAEIVEHGVTGVTFAPGDPAALAEAVGAVLADRDYARSLAL
RARSRVREDFSWQTIAGQTVAVYDQARAADSRRVAREAESLLNHVPATRHATA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcctgatgctctcctgggagtatccgccgctgctggtgggcggcctgggccgg
cacgtgcacgcgctcgccaccacgctcgtcgcggccgggcacgacgtgacggtggtgacc
cggcacacgcccggcgcgctgaccgaggagtacaccgagggcgtccgggtggtccgcgcc
ccggacgacccgccgaccgccaccggcgcggacgacgacatgctgggctgggcgatggcg
ttcaaccacacactcacccgggccgcgctacgcgcctcccgcaccgagcggtacgacgtg
gtgcacgcccacgactggctcgtcgcgcacgccgccgtgacactgcgcgaccacctggac
gtgccgctcgtcgccaccgtccacgccaccgagtccggccggcaccagggctggctgccg
gccccggcgaaccgggccatcgacggcatcgagcgctggctctgcgccgaggcggtccgg
gtgatcgtctgctcggcgtacatgaaacgcgaggtcatccggctgttcgacgtgccgccg
agccgcgccgaggtggtcttcaacggggtggacgcgctgcgctggcgtgcccggccccgt
gccgtggaggcggcccgcgcccggtacgccggcgacggcccgctgatcagcttcgccggg
cggctcgtctacgagaagggcgtgcagcacctcatggcggccgtcccgatgctgcgggaa
cgccatcccggcctccgggtcgtgatcgcgggcgacggcccgtaccggaaggatctcgaa
gatctggccggctcgctcggggtgagcttcgcggggttcctgggcgggcacgagctgacc
gcgctgatgggcgcgtcggactgttacgtggtgccgagcatctacgagccgttcgggatg
gtcgcgctggaggcggcggcggccggcacccccgtcgcggtggccggcaccggcggcctc
gccgagatcgtggagcacggggtcaccggggtgacgttcgcgcccggcgatccggcggcg
ctggccgaggcggtcggcgcggtgctcgcggaccgcgactatgcccggtcgctggcgttg
cgggcccggtcgcgggtgcgcgaggacttctcctggcagaccatcgcggggcagaccgtc
gcggtctacgaccaggcgcgggcggcggactcccggcgggtcgcgcgggaggcggagagc
ctgctcaaccacgtcccggcaacccgccacgccacggcctga

DBGET integrated database retrieval system