KEGG   Actinoplanes missouriensis: AMIS_64870Help
Entry
AMIS_64870        CDS       T01795                                 

Definition
putative beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ams  Actinoplanes missouriensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AMIS_64870
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AMIS_64870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6975892..6977859)
Genome map
AA seq 655 aa AA seqDB search
MFKRKTGISLGCDYNPEQWSPDVWREDVALMRQAGVDLVAVNIFGWSNVEPSPGRYHFDD
LDEVIGLLHENGIQVNLGTGTSSPPPWLSTLYPEILPAAADGTIRFPGGRQAWCPSSPVF
REKALALVEQVAQRYGSHPAVALWHVSNELGCHNALCYCDASAEAFRGWLRERYRKIETL
NEAWGTSFWSQRYGDWSEIQPPRLALSLRNPAQIVDFHRFSSDELLGYYRAEAEILRRHS
DIKVTTNFMVTAHIRNLDYWSWAPEMDVVANDHYLDHRLGDPVAELSFAADLTRGLAGGK
PWMLMEQAAGAVNWQPHNLTKAPGEMIRNSLTHVARGADSLCFFQWRASAQGAEKFHSAL
LPHAGTDTVAWREVLRLSETLDRIGEVAGTEVESDVALVFSWESWWSAEGEARPSQAVTY
LDQVHRAHRALRELGVTTDVVAPGADLEKYKLVVVPCLYMVSDEAAERMAAYVENGGSLL
VTFFSGIVDERDRIRLGGYPGAFKDVLGVHGEEFAPLLPGHQVRLSNGATGTTWTERLRT
TTAETVATYTDGPMPGVPAITRNGNAWYVATELDPRGLRELVRDAVTAAGVTAAGPESNG
DVEVVRRSGDGRSYLFVINHGTQPVAIETGHDLVTDTEISNVGAGQTAVIREVTA
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagcggaagaccgggatcagcctcggctgtgactacaacccggaacaatggtcg
cccgacgtgtggcgcgaggatgtcgcgctcatgcgtcaggccggcgtcgacctggtggcc
gtcaacatcttcggctggtcgaacgtggagccgagccccggccggtaccacttcgacgac
ctcgacgaggtcatcggcctgctgcacgagaacgggatccaggtcaatctgggtacggga
acgagcagcccgccgccgtggctcagcaccctgtacccggagatcctgccggccgcggcc
gacgggacgatccggttccccggcggccgccaggcctggtgcccgagttcgccggtcttc
cgggagaaggcgctcgccctggtcgagcaggtcgcccagcggtacggcagccaccccgcc
gtcgcgctctggcacgtctcgaacgagctgggctgccacaacgcgctctgctactgcgac
gcgagcgccgaggccttccggggctggctgcgcgagcgctaccgcaagatcgagacgctg
aacgaggcctggggcacgtcgttctggagccagcggtacggcgactggtcggagatccag
ccgccgcggctggcgctctcgctgcgcaacccggcccagatcgtcgacttccaccggttc
agctccgacgagctgctcggctactaccgcgccgaggcggagatcctgcgccgtcactcg
gacatcaaggtgaccacgaacttcatggtcaccgcacacatccgcaacctcgactactgg
tcctgggcgccggagatggacgtcgtcgcgaacgaccactacctcgaccaccgcctcggc
gacccggtcgcggagctctccttcgccgccgacctgacccgtggcctggccggcggcaag
ccgtggatgctcatggagcaggcggccggcgcggtgaactggcagccgcacaacctgacc
aaggcgccgggcgagatgatccgtaactcgctgacccacgtggcccggggcgccgactcc
ctctgcttcttccagtggcgggcctccgcgcagggcgccgagaagttccactccgcgctg
ctgccgcacgccggcaccgacaccgtcgcctggcgggaggtgctgcggctctccgagacc
ctggaccggatcggcgaggtggccggcaccgaggtcgagtcggacgtcgcgctggtcttc
agctgggagtcctggtggtcggcggagggcgaggcccgcccgtcgcaggcggtcacctat
ctcgaccaggtccaccgcgcgcaccgggcgctgcgtgagctcggcgtcaccaccgacgtg
gtcgcccccggcgcggacctcgagaagtacaagctggtcgtggtgccgtgcctctacatg
gtgagcgacgaggccgcggagcggatggcggcgtacgtcgagaacggcgggagcctcctc
gtcacgttcttctccgggatcgtcgacgagcgggaccggatccgcctcggcggctatccg
ggggcgttcaaggacgtgctcggcgttcacggcgaggagttcgccccgctgctgccgggc
caccaggtcaggctctccaacggcgcgaccgggacgacgtggaccgagcgcctgcgcacc
accacggcggagaccgtcgccacctacaccgacgggccgatgcccggcgtcccggcgatc
acccgcaacggcaacgcctggtacgtcgcgaccgagctcgacccgcgtggcctgcgcgag
ctggtccgggacgcggtgaccgccgccggcgtcacggcggccggcccggaatcgaacggc
gacgtcgaggtggtccggcgctccggcgacggccgctcctatctcttcgtgatcaaccac
ggcacgcagcccgtggcgatcgaaaccggtcacgacctcgtgaccgacaccgagatcagc
aacgtcggagcaggacagacggcggttatccgggaggtgacggcatga

DBGET integrated database retrieval system