KEGG   Actinoplanes missouriensis: AMIS_6550Help
Entry
AMIS_6550         CDS       T01795                                 

Definition
putative uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ams  Actinoplanes missouriensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMIS_6550
Enzymes [BR:ams01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AMIS_6550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(693712..694857)
Genome map
AA seq 381 aa AA seqDB search
MTDRPPGARRAALTAAALAEPAAALSGYTIGVTADGRKDELATLLEARGARVVLAPALRI
VPIADDAELRAATRACLDTPPDIVLVNTGIGMRGWLEAAEGWGLAEPLRSVLSRAYLVAR
GPKARAAVRTAGLHEQWTPDGEGYEEVVDHLTARGLTGLTVALQLHGDSQPEYTEALQRA
GARVIEAPVYRWAPPVDQAPLHRLVDLIIGKLVDTVTFTSAAAVQAVLRAAGTGADALFD
SLRGDVLAACVGPVTAAPLRRQGIPVVTPGRARLSALVRTIVDELPKRAVTLEVAGHSLT
LRGHAAIVDGELRPLAPAPMAVLRELAGSPGRVLSRAALLQSLPRGADEHAVEMAVARLR
AGLAVPGVVQTVVKRGYRLPA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccggccccccggcgcccgccgggccgcgctgaccgctgccgccctcgcggag
ccggcggcggccctctccggttacacgatcggcgtgaccgccgacggccgcaaggacgag
ctcgccaccctcctcgaagcccgcggcgcccgcgtggtgctggcgccggccctgcgcatc
gtcccgatcgccgacgacgccgaactgcgcgccgcgacccgggcctgcctcgacacgcca
cccgacatcgtgctggtcaacacgggtatcggcatgcgtggctggctggaggccgcggag
gggtggggtcttgccgagccgctgcggtcggtgctgtcccgggcgtacctggtggcccgt
gggccgaaggcacgcgccgcggtccgcaccgccggtctgcacgagcagtggacacccgac
ggcgagggttacgaggaggtcgtcgaccacctgaccgcccgcggcctgaccggtctcacg
gtggccctgcagctgcacggcgacagtcagccggagtacaccgaggcattgcagcgggcc
ggcgcccgggtgatcgaggcgccggtctaccgctgggcgccgcccgtcgatcaggcgccg
ctgcaccggctggtcgatctgatcatcggcaagctggtggacaccgtgacgttcacgtcg
gccgccgcggtccaggccgtgctgcgcgccgccggcaccggtgccgacgccctcttcgac
tcgctgcgcggcgacgtcctggcagcctgtgtcggacctgtcaccgcagcgccgctgcgc
cgtcagggcatcccggtcgtcactccgggtcgcgcccggctcagcgccctcgtccgcacg
atcgtcgacgagctgccgaaacgcgccgtcaccctggaggtggccggccattccctgacg
ctgcgcggccacgcggcgatcgtcgacggcgaactccgccccctggcgccggccccgatg
gcggtcctccgcgagctcgccggttcacccggacgggtcctctcccgcgccgcgctcctg
caatcacttccgcgcggcgccgacgaacacgccgtcgagatggccgtcgcccgcctgcgc
gccggtcttgccgtacccggtgtggtccagaccgtcgtcaagcgcggctaccggcttccc
gcctga

DBGET integrated database retrieval system