KEGG   Actinoplanes missouriensis: AMIS_67730Help
Entry
AMIS_67730        CDS       T01795                                 

Definition
putative cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ams  Actinoplanes missouriensis
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    AMIS_67730
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     AMIS_67730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7342852..7344483
Genome map
AA seq 543 aa AA seqDB search
MTHYDIVVVGSGFGGSVSALRLAEKGYRVGVLEAGRRFTPETLPKTSWDLRNFLWAPRLG
MRGMQRITLLKDIMVLSAAGVGGGSLVYANTLYRPPAPFFADPHWSGITDWADELAVFYD
QASRMLGVTEQPTMTPSDVVIKQVADDMGVGHTFRRTPVGVYFGEPGKTVPDPYFGGAGP
DRTGCVECGNCMIGCKVGAKNRLDVNYLYLAERSGAVVHPDTEVTSLRPGWRLETTKGTF
TADQVILSAGALGTQRLLHAMKDTGVLPQLSDRLGELTRTNSEALLGAAVKDVPAEPFSR
GIAITSSFHPDPDTHIEPVRYGPGSNAMGLLSTLLVDGGGRIPRPLRFLGQALRHPVVLA
HSLSVRRWSERTIIALVMQSVDNSLTVRRTRRGRLTTSLGHGKPNPVWIPVGHEAVRRLA
DRIGGYPGGTVGDIFNIPLTAHILGGATIGESASSGVVDAYHRVWGCPGLHVVDGSAVPA
NLGVNPSLTITAMAERAMSLWPNKGDEDPRPAPGSGYRRLAPVPPHFPAVPAHAPTALRL
HPR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacgcattacgacatcgtcgtcgtcggcagcggcttcggcggcagcgtcagcgccctg
cgcctggcggagaagggataccgggtcggcgtgctcgaggccggccgccgattcaccccg
gagacactgcccaagacctcctgggacctgcgcaacttcctctgggccccacgcctcggc
atgcgcggcatgcagcggatcacgctgctcaaggacatcatggtgctctccgcggcgggc
gtcggcggcggctcgctggtctacgcgaacacgctctaccggccgccggcgccgttcttc
gccgacccgcactggtccgggatcaccgactgggcggacgagctggcggtcttctacgac
caggcgtcgcgcatgctcggcgtcaccgagcagcccaccatgaccccctccgacgtcgtg
atcaagcaggtggccgacgacatgggcgtcgggcacacgttccggcgcacccccgtcggc
gtctacttcggcgagcccggcaagaccgtgcccgacccgtacttcgggggcgccggcccg
gaccgcaccggctgcgtcgagtgcggcaactgcatgatcggctgcaaggtcggcgcgaag
aaccggctcgacgtcaactacctctacctggccgaacggtccggcgccgtggtgcacccg
gacaccgaggtgacctcgctgcgcccgggctggcgcctggagaccaccaagggaacgttc
accgccgatcaggtgatcctttcggccggggcgctcggcacccagcggctgctgcacgcc
atgaaagacaccggggtgctgccgcagctgtcggatcggctgggtgagctgacccgtacc
aactcggaggccctgctcggcgccgccgtcaaggacgtccccgccgagcccttctcccgg
ggcatcgcgatcacgtcgtcgttccaccccgaccccgacacccacatcgaacccgtccgc
tacggccccggcagcaacgcgatgggcctgctctccaccctgctcgtggacggcggcggc
cggatcccgcggccgctgcggttcctcggccaggcgctgcggcacccggtcgtgctggcc
cactccctgtcggtacggcggtggagcgaacggaccatcatcgcgctcgtcatgcagtcg
gtggacaactcgctgaccgtacggcgtacccgtcgcggacggctcaccacctcgctcggg
cacggcaagcccaacccggtctggatcccggtcggccacgaggcggtccgccgtctcgcc
gaccggatcggcggctacccgggcggcaccgtgggagacatcttcaacatcccgctcacc
gcgcacatcctcggcggggccacgatcggggagtcggcgtcgtccggggtcgtcgacgcg
taccaccgggtctggggttgccccgggctgcacgtggtggacggctcggcggtgccggcg
aacctcggggtcaacccctcgctgaccatcacggccatggcggaacgggcgatgtcgctc
tggcccaacaagggcgacgaggacccgcgcccggcacccggaagcggttaccgccggctc
gccccggtcccgccccacttccccgccgtaccggcccacgcgccgaccgccctgcgactg
cacccacgatga

DBGET integrated database retrieval system