KEGG   Actinoplanes missouriensis: AMIS_68020Help
Entry
AMIS_68020        CDS       T01795                                 

Definition
(GenBank) hypothetical protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00010  Glycolysis / Gluconeogenesis
ams00520  Amino sugar and nucleotide sugar metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01200  Carbon metabolism
Module
ams_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_68020
   00520 Amino sugar and nucleotide sugar metabolism
    AMIS_68020
Enzymes [BR:ams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AMIS_68020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAL92022
UniProt: I0HG85
Position
7372369..7373136
Genome map
AA seq 255 aa AA seqDB search
MHTGRVAFTLTIDCGGGGIKGSVLDEAGTMRAHPIRVPTPYPLPPELFVKTLVSLGEQLP
NADRVTVGMPGMIRHGVVVATPHYVTRSGPRTRVDPELFEAWRGFDARTALADAFGLPTL
VLNDAEVHGAGVVAGTGCELVLTLGTGLGCALFDGGELAPHLEMSQAPVRWGMSYDTYIG
EHERRRLGDALWSRRVRNVIEGLRPVFLWDRVYLGGGNSRLITATQLARMGDDVVVVPNT
AGIVGGVRAWTLGQR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcacactggccgcgtggctttcaccctgacgattgactgtggcggcggcggcatcaag
ggctctgtcctcgacgaggccggcacgatgcgggcacacccgatccgggtcccgacaccg
tacccattgcctcccgaactcttcgtcaagactctggtgagtctcggcgaacagttgccg
aacgccgatcgggtcaccgtcggcatgcccggcatgatccggcacggcgtggtcgtggcg
accccgcactacgtgacacgtagcggcccgcgtaccagggtggacccggagttgttcgag
gcgtggcgcgggttcgacgcgcggaccgctctcgccgacgcgttcgggctgcccacgctg
gtgctcaacgacgccgaggtgcacggcgcgggcgtggtcgcgggcaccggctgcgagctg
gtgctgaccctcggcaccgggctgggctgcgccctcttcgacggcggtgagctggcgccg
cacctggagatgtcgcaggcgccggtgcgctgggggatgtcctacgacacgtacatcggt
gaacatgaacgccgccgcctcggcgacgcgctctggtcgcgccgggtgcgcaacgtgatc
gagggcctgcggccggtcttcctctgggatcgggtctatctcggcggcggcaacagccgc
ctgatcaccgccacgcagctggcccggatgggcgacgatgtggtcgtggtgccgaacacc
gcgggcatcgtcggcggcgtccgcgcctggaccctgggtcagcgatga

DBGET integrated database retrieval system