KEGG   Actinoplanes missouriensis: AMIS_71550Help
Entry
AMIS_71550        CDS       T01795                                 

Definition
putative PfkB-family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ams  Actinoplanes missouriensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMIS_71550
Enzymes [BR:ams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AMIS_71550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7753452..7754360)
Genome map
AA seq 302 aa AA seqDB search
MAPRVVVAGSANMDLVGLAPALPRPGETVLGDDFVMAPGGKGSNQAIAAARAGGATTFLG
AIGSDAFGVTLGARLAAAGVDTGRVRTSYGASGVAVIMVDRAGENSILVSPGANRTFTGL
TADEQSVIAGADVLLCQQEIPMETVHAALRAGRAGGTRTILNAAPARDLPAGLLDEVDLL
VVNEIEARAITGTEVHDPAGMAALLALVPRVVLTLSGSGARFADRDGRDVHVPAFAVPVA
DTTAAGDAFTGALAVAWGEGRDLVDAVRWANAAGAVCVQRVGASTALPERAEIDRLYASG
AS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccgggtcgtcgtcgccggcagcgcgaacatggacctcgtcgggctggcgccg
gcgttgccccggccgggtgaaaccgtgctcggtgacgatttcgtgatggcgcccggcggc
aagggctcgaaccaggccatcgcggccgcgcgggccggtggcgcgaccacgttcctcggc
gcgatcggctcggacgcgttcggggtcaccctgggcgcgcggctggccgccgcgggcgtc
gacaccgggcgggtacgcacgagctacggcgcctccggtgtcgcggtgatcatggtggac
cgggccggcgagaactccatcctggtcagcccgggggcgaaccggacgttcaccggcctc
accgccgacgagcagtcggtgatcgccggagccgacgtgctgctctgccagcaggagatt
ccgatggagacggtgcacgccgcgctccgggccggccgggccggcggcacccgcaccatc
ctcaacgccgcaccggctcgggacctgccggccggcctgctcgacgaggtcgacctgctg
gtggtcaacgagatcgaggcgcgggccatcaccggcacggaggttcatgatccggccggc
atggcggcgctgctggcgctggtgccgcgggtggtgctcacgctcagtggctccggcgcc
cggttcgccgaccgcgacggccgggacgtgcacgtgccggccttcgcggtgcctgtcgcc
gacaccacggccgccggcgacgcgttcaccggcgccctcgcggtggcctggggcgagggc
cgcgacctggtggacgcggtccgctgggccaacgcggcaggcgcggtctgcgtccagcgg
gtgggtgccagcaccgcgctcccggaacgcgccgagatcgaccggctgtacgcgagcggg
gcgagctga

DBGET integrated database retrieval system