KEGG   Actinoplanes missouriensis: AMIS_71580Help
Entry
AMIS_71580        CDS       T01795                                 

Definition
putative glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ams  Actinoplanes missouriensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMIS_71580
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AMIS_71580
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AMIS_71580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7756573..7758024
Genome map
AA seq 483 aa AA seqDB search
MSHDPGLRRLALRTLLAAFPGATAPDWALELVADGLAGHTLFATNVDDPAQLAALTGTLR
TARPDVLVAIDEEGGDVTRLGHHAGSPYPGNAALGAVDDPDLTRRVYAAIGGDLAAAGVN
LDLAPTVDVNTADENPIIGTRSFGADPDLVARHAAAAVTGLESTGVAACAKHFPGHGATV
SDSHLELPTVDVPLDVLRTRDLPPFAAAVAAGAQAVMSAHIRVPALTGAGPATFSRAALT
GLLREELGFRGAIVTDALEMRGAAGAAGSIPLAAVAALSAGADLLCIGASVGRELVEQVA
LEIAAAVRDGRLAQSRLEGAAARTAALAAWAAAPRPAAESDGELGAAAARLAVRVEGAPS
PLPSPLVVRLVSGSSIAEGRVPWGLRPHLNGIEQVDLVAASTTADEVAALAGDRPVVVVG
RRLHSSAPARDLVEKLAVARQVSVVEMGWPSSWRPAGVAAFVVTHGASLANGRAAAEALH
LAG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacgatccgggccttcgccggctcgccctgcgcaccctgctcgcggccttcccc
ggcgccaccgcgccggactgggcgctcgaactcgtcgccgacgggctcgccgggcacacc
ctgttcgcgacgaacgtggacgaccccgcccagctcgccgccctgaccgggacactccgg
acggcccgccccgatgtgctggtcgccatcgacgaagagggcggcgacgtcacccggctg
gggcatcacgcgggtagcccgtaccccggaaacgccgccctcggcgcggtggacgacccg
gatctcacccgccgggtctatgccgccatcggcggcgacctggccgccgccggcgtgaac
ctcgacctcgcgcccaccgtcgacgtcaacaccgccgacgagaacccgatcatcggaacc
cgctccttcggcgccgaccccgacctggtcgcccggcacgccgccgcggccgtcaccggc
ctggaatcgacaggcgtcgcggcctgcgccaaacacttccccggccacggcgccacggtc
agcgactcgcacctcgaactgcccaccgtcgacgtgccactggacgtgctgcgcacgcgg
gacctgccgccgttcgccgcggcggtggcggccggcgcgcaggccgtgatgagcgcccac
atccgggtgcccgcactcaccggggccgggcccgcgacgttcagccgggccgcgctcacc
ggcctgctccgcgaggagctcggcttccggggcgcgatcgtgacggacgccctggagatg
cgcggggcggcgggggcagccgggagcattccgctcgccgcggtggccgcgctctccgcc
ggggccgacctgctctgcatcggcgcgtcggtcggacgggagctggtggagcaggtcgcc
ctcgagatcgctgcggcggtgcgggacgggcggctcgcgcagtcgcggctggagggtgcc
gcggcgcgaaccgcggcgcttgccgcctgggcggctgcgccgcgcccggcggcggaatcg
gacggcgagctgggtgcggcggcggcacgattggcggtacgcgtggagggggccccctcc
cccctcccctcccccctcgtcgtgcggctggtgtccggctcctcgatcgccgaagggcgc
gtgccgtggggcctgcgcccacacctgaacggcatcgagcaggtcgacctcgtcgcggcg
tcgacgaccgccgacgaggtcgcggcgctcgccggtgaccggcccgtggtcgtcgtcggc
cggcgactgcacagttcggcaccggcccgggatctcgtggagaaactggccgtcgcgcga
caggtcagcgtcgtcgagatgggctggccgtcgagctggcggccggccggggtggcggcc
ttcgtggtgacgcacggcgcgagtctcgcgaacgggcgggccgccgcggaggccctgcac
ctggccggctga

DBGET integrated database retrieval system