KEGG   Actinoplanes missouriensis: AMIS_7160Help
Entry
AMIS_7160         CDS       T01795                                 

Definition
(RefSeq) putative succinyl-CoA synthetase beta chain
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ams  Actinoplanes missouriensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_7160
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMIS_7160
   00640 Propanoate metabolism
    AMIS_7160
   00660 C5-Branched dibasic acid metabolism
    AMIS_7160
Enzymes [BR:ams01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AMIS_7160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
763989..765167
Genome map
AA seq 392 aa AA seqDB search
MDLFEYQGRDLFERHGLPVLGGGVAETPQEARAIAERLGGKVVVKAQVKVGGRGKAGGVK
LADGADEAEARATDILGMDIKGHTVHKVMLAETADIKEEYYFSYLLDRANRTFLCIASVA
GGMEIETVAETDPDRVAKVAIDASKGVDEAKAREIVTLAKFPADVADQVVDIAVKLWQAF
VAEDALLVEVNPLAKVGDGRVLALDAKVTLDENAGFRHPDHEALEDKSAVDPIEQAAKAK
NLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAQVMANGLE
IVLGDPSVKSVFVNVFGGITACDAVANGIIQALALLAERGETVTKPLVVRLDGNNAEEGR
AILDGANNPLVQRVDTMDGAAARAAELAAAGK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtatcaggggcgcgacctgttcgaacggcacgggctgcccgtgctg
ggcggcggtgtcgccgagaccccgcaggaagcccgggcgatcgccgagcggctcggcggc
aaggtcgtcgtcaaggcccaggtcaaggtcggtggccgtggtaaggccggcggcgtgaag
ctggccgacggcgcggacgaggccgaggctcgcgcgaccgacatcctgggcatggacatc
aagggccacacggtccacaaggtgatgctggccgagacggccgacatcaaggaggagtac
tacttctcctacctgctggaccgggccaaccggaccttcctctgcatcgccagcgtcgcc
ggcggcatggagatcgagacggtcgccgagaccgacccggaccgggtcgccaaggtcgcc
atcgacgccagcaagggcgtggacgaggccaaggcgcgggagatcgtcaccctcgccaag
ttcccggccgacgtcgccgaccaggtcgtcgacatcgcggtgaagctctggcaggcgttc
gtcgccgaggacgcgctcctcgtcgaggtcaacccgctcgccaaggtcggcgacggccgg
gtgctcgcgctcgacgccaaggtcacgctggacgagaacgccggcttccggcaccccgac
cacgaggccctcgaggacaagtcggccgtcgacccgatcgagcaggccgccaaggcgaag
aacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgccggcctg
gtcatgtcgaccctcgacgtggtcgcctacgccggtgagaagcacggcggcgtcaagccg
gcgaacttcctcgacatcggtggcggcgccagcgcccaggtgatggcgaacggtctggag
atcgtgctcggcgacccgtccgtgaagtccgtcttcgtcaacgtgttcggtggcatcacc
gcctgcgacgcggtcgccaacggcatcatccaggccctggccctgctcgccgagcgcggc
gagaccgtcaccaagccgctcgtggtccgcctcgacggcaacaacgccgaagagggacgt
gccatcctcgacggtgcgaacaacccgctggtccagcgggtggacacgatggacggagcg
gccgctcgcgccgccgagctcgcggctgcggggaagtga

DBGET integrated database retrieval system