KEGG   Actinoplanes missouriensis: AMIS_7160Help
Entry
AMIS_7160         CDS       T01795                                 

Definition
putative succinyl-CoA synthetase beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ams  Actinoplanes missouriensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMIS_7160
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMIS_7160
   00640 Propanoate metabolism
    AMIS_7160
   00660 C5-Branched dibasic acid metabolism
    AMIS_7160
Enzymes [BR:ams01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AMIS_7160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
763989..765167
Genome map
AA seq 392 aa AA seqDB search
MDLFEYQGRDLFERHGLPVLGGGVAETPQEARAIAERLGGKVVVKAQVKVGGRGKAGGVK
LADGADEAEARATDILGMDIKGHTVHKVMLAETADIKEEYYFSYLLDRANRTFLCIASVA
GGMEIETVAETDPDRVAKVAIDASKGVDEAKAREIVTLAKFPADVADQVVDIAVKLWQAF
VAEDALLVEVNPLAKVGDGRVLALDAKVTLDENAGFRHPDHEALEDKSAVDPIEQAAKAK
NLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAQVMANGLE
IVLGDPSVKSVFVNVFGGITACDAVANGIIQALALLAERGETVTKPLVVRLDGNNAEEGR
AILDGANNPLVQRVDTMDGAAARAAELAAAGK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtatcaggggcgcgacctgttcgaacggcacgggctgcccgtgctg
ggcggcggtgtcgccgagaccccgcaggaagcccgggcgatcgccgagcggctcggcggc
aaggtcgtcgtcaaggcccaggtcaaggtcggtggccgtggtaaggccggcggcgtgaag
ctggccgacggcgcggacgaggccgaggctcgcgcgaccgacatcctgggcatggacatc
aagggccacacggtccacaaggtgatgctggccgagacggccgacatcaaggaggagtac
tacttctcctacctgctggaccgggccaaccggaccttcctctgcatcgccagcgtcgcc
ggcggcatggagatcgagacggtcgccgagaccgacccggaccgggtcgccaaggtcgcc
atcgacgccagcaagggcgtggacgaggccaaggcgcgggagatcgtcaccctcgccaag
ttcccggccgacgtcgccgaccaggtcgtcgacatcgcggtgaagctctggcaggcgttc
gtcgccgaggacgcgctcctcgtcgaggtcaacccgctcgccaaggtcggcgacggccgg
gtgctcgcgctcgacgccaaggtcacgctggacgagaacgccggcttccggcaccccgac
cacgaggccctcgaggacaagtcggccgtcgacccgatcgagcaggccgccaaggcgaag
aacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgccggcctg
gtcatgtcgaccctcgacgtggtcgcctacgccggtgagaagcacggcggcgtcaagccg
gcgaacttcctcgacatcggtggcggcgccagcgcccaggtgatggcgaacggtctggag
atcgtgctcggcgacccgtccgtgaagtccgtcttcgtcaacgtgttcggtggcatcacc
gcctgcgacgcggtcgccaacggcatcatccaggccctggccctgctcgccgagcgcggc
gagaccgtcaccaagccgctcgtggtccgcctcgacggcaacaacgccgaagagggacgt
gccatcctcgacggtgcgaacaacccgctggtccagcgggtggacacgatggacggagcg
gccgctcgcgccgccgagctcgcggctgcggggaagtga

DBGET integrated database retrieval system