KEGG   Actinoplanes missouriensis: AMIS_7160Help
Entry
AMIS_7160         CDS       T01795                                 

Definition
(GenBank) putative succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00020  Citrate cycle (TCA cycle)
ams00640  Propanoate metabolism
ams00660  C5-Branched dibasic acid metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01200  Carbon metabolism
Module
ams_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ams_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMIS_7160
   00640 Propanoate metabolism
    AMIS_7160
   00660 C5-Branched dibasic acid metabolism
    AMIS_7160
Enzymes [BR:ams01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AMIS_7160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: BAL85936
UniProt: I0GYU9
Position
763989..765167
Genome map
AA seq 392 aa AA seqDB search
MDLFEYQGRDLFERHGLPVLGGGVAETPQEARAIAERLGGKVVVKAQVKVGGRGKAGGVK
LADGADEAEARATDILGMDIKGHTVHKVMLAETADIKEEYYFSYLLDRANRTFLCIASVA
GGMEIETVAETDPDRVAKVAIDASKGVDEAKAREIVTLAKFPADVADQVVDIAVKLWQAF
VAEDALLVEVNPLAKVGDGRVLALDAKVTLDENAGFRHPDHEALEDKSAVDPIEQAAKAK
NLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAQVMANGLE
IVLGDPSVKSVFVNVFGGITACDAVANGIIQALALLAERGETVTKPLVVRLDGNNAEEGR
AILDGANNPLVQRVDTMDGAAARAAELAAAGK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtatcaggggcgcgacctgttcgaacggcacgggctgcccgtgctg
ggcggcggtgtcgccgagaccccgcaggaagcccgggcgatcgccgagcggctcggcggc
aaggtcgtcgtcaaggcccaggtcaaggtcggtggccgtggtaaggccggcggcgtgaag
ctggccgacggcgcggacgaggccgaggctcgcgcgaccgacatcctgggcatggacatc
aagggccacacggtccacaaggtgatgctggccgagacggccgacatcaaggaggagtac
tacttctcctacctgctggaccgggccaaccggaccttcctctgcatcgccagcgtcgcc
ggcggcatggagatcgagacggtcgccgagaccgacccggaccgggtcgccaaggtcgcc
atcgacgccagcaagggcgtggacgaggccaaggcgcgggagatcgtcaccctcgccaag
ttcccggccgacgtcgccgaccaggtcgtcgacatcgcggtgaagctctggcaggcgttc
gtcgccgaggacgcgctcctcgtcgaggtcaacccgctcgccaaggtcggcgacggccgg
gtgctcgcgctcgacgccaaggtcacgctggacgagaacgccggcttccggcaccccgac
cacgaggccctcgaggacaagtcggccgtcgacccgatcgagcaggccgccaaggcgaag
aacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgccggcctg
gtcatgtcgaccctcgacgtggtcgcctacgccggtgagaagcacggcggcgtcaagccg
gcgaacttcctcgacatcggtggcggcgccagcgcccaggtgatggcgaacggtctggag
atcgtgctcggcgacccgtccgtgaagtccgtcttcgtcaacgtgttcggtggcatcacc
gcctgcgacgcggtcgccaacggcatcatccaggccctggccctgctcgccgagcgcggc
gagaccgtcaccaagccgctcgtggtccgcctcgacggcaacaacgccgaagagggacgt
gccatcctcgacggtgcgaacaacccgctggtccagcgggtggacacgatggacggagcg
gccgctcgcgccgccgagctcgcggctgcggggaagtga

DBGET integrated database retrieval system