KEGG   Actinoplanes missouriensis: AMIS_72260Help
Entry
AMIS_72260        CDS       T01795                                 

Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMIS_72260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMIS_72260
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AMIS_72260
Enzymes [BR:ams01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AMIS_72260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7837905..7838954
Genome map
AA seq 349 aa AA seqDB search
MWRGLIEAYRDRLPVTDATPVVSLHEGNTPLVPAPVLSSRVGADVYLKVEGANPTGSFKD
RGMTMAVSKAVEEGAKAIICASTGNTSASAAAYAARAGITCAVLVPQGKIALGKLAQALV
HGARLLQVDGNFDDCLALASKLSQDYPVALVNSVNIFRLHGQKTASFEIVEALGDAPDIH
CLPVGNAGNISAYWMGYQEDQAAGNSTKLPKMYGFQASGAAPIVNGKVVENPSTIATAIR
IGNPASWTKALDARDASGGLISAVTDRDILNAYRLLAREVGVFVELGSAASVAGLLQQAA
AGQIPAGSRVVCTVTGHGLKDPEWAISTAPSPTVIANDALIAAKALDLA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggggcttgattgaggcgtaccgggaccggctgccggtcaccgacgccacgccg
gtggtctcgttgcacgagggcaacaccccgctggtgccggcgccggtgctctcgtcgcgg
gtcggcgcggacgtctacctcaaggtggagggcgccaacccgaccggctccttcaaggac
cgcggcatgacgatggctgtctccaaggccgtcgaggagggcgccaaggcgatcatctgc
gcctccaccggcaacaccagcgcgtccgccgccgcctacgccgcccgggccggcatcacc
tgcgccgtcctggtgccgcagggcaagatcgcgctcggcaagctggcccaggcgctcgtg
cacggcgcccggctgctccaggtcgacggcaacttcgacgactgtctcgcgctcgcctcc
aagctctcccaggactacccggtcgccctggtcaactcggtgaacatcttccgcctgcac
gggcagaagaccgcgtccttcgagatcgtggaagcgctcggcgacgcccccgacatccac
tgcctcccggtcggcaacgccggcaacatctcggcgtactggatgggttaccaggaggac
caggccgccggaaactccacgaagctgccgaagatgtacggcttccaggcctccggcgcc
gcgcccatcgtgaacggcaaggtcgtcgagaacccgtcgaccatcgccaccgcgatccgg
atcggcaacccggccagctggaccaaggccctcgacgcccgcgacgcatccggcggcctg
atctccgcggtcaccgaccgtgacatcctcaacgcctaccgcctgctcgcccgcgaggtc
ggcgtcttcgtcgaactgggcagcgcggcaagcgtcgccggcctgttgcagcaggcagcg
gcaggccagatcccggccggttcccgggtcgtctgcacggtcaccggccacggcctcaag
gacccggagtgggcgatctccaccgctccgtcgccgacggtcatcgccaacgacgccctg
atcgccgcaaaggccctcgacctggcctga

DBGET integrated database retrieval system