KEGG   Actinoplanes missouriensis: AMIS_72260Help
Entry
AMIS_72260        CDS       T01795                                 

Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ams  Actinoplanes missouriensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ams01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ams00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ams00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7837905..7838954
Genome map
AA seq 349 aa AA seqDB search
MWRGLIEAYRDRLPVTDATPVVSLHEGNTPLVPAPVLSSRVGADVYLKVEGANPTGSFKD
RGMTMAVSKAVEEGAKAIICASTGNTSASAAAYAARAGITCAVLVPQGKIALGKLAQALV
HGARLLQVDGNFDDCLALASKLSQDYPVALVNSVNIFRLHGQKTASFEIVEALGDAPDIH
CLPVGNAGNISAYWMGYQEDQAAGNSTKLPKMYGFQASGAAPIVNGKVVENPSTIATAIR
IGNPASWTKALDARDASGGLISAVTDRDILNAYRLLAREVGVFVELGSAASVAGLLQQAA
AGQIPAGSRVVCTVTGHGLKDPEWAISTAPSPTVIANDALIAAKALDLA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggggcttgattgaggcgtaccgggaccggctgccggtcaccgacgccacgccg
gtggtctcgttgcacgagggcaacaccccgctggtgccggcgccggtgctctcgtcgcgg
gtcggcgcggacgtctacctcaaggtggagggcgccaacccgaccggctccttcaaggac
cgcggcatgacgatggctgtctccaaggccgtcgaggagggcgccaaggcgatcatctgc
gcctccaccggcaacaccagcgcgtccgccgccgcctacgccgcccgggccggcatcacc
tgcgccgtcctggtgccgcagggcaagatcgcgctcggcaagctggcccaggcgctcgtg
cacggcgcccggctgctccaggtcgacggcaacttcgacgactgtctcgcgctcgcctcc
aagctctcccaggactacccggtcgccctggtcaactcggtgaacatcttccgcctgcac
gggcagaagaccgcgtccttcgagatcgtggaagcgctcggcgacgcccccgacatccac
tgcctcccggtcggcaacgccggcaacatctcggcgtactggatgggttaccaggaggac
caggccgccggaaactccacgaagctgccgaagatgtacggcttccaggcctccggcgcc
gcgcccatcgtgaacggcaaggtcgtcgagaacccgtcgaccatcgccaccgcgatccgg
atcggcaacccggccagctggaccaaggccctcgacgcccgcgacgcatccggcggcctg
atctccgcggtcaccgaccgtgacatcctcaacgcctaccgcctgctcgcccgcgaggtc
ggcgtcttcgtcgaactgggcagcgcggcaagcgtcgccggcctgttgcagcaggcagcg
gcaggccagatcccggccggttcccgggtcgtctgcacggtcaccggccacggcctcaag
gacccggagtgggcgatctccaccgctccgtcgccgacggtcatcgccaacgacgccctg
atcgccgcaaaggccctcgacctggcctga

DBGET integrated database retrieval system