KEGG   Actinoplanes missouriensis: AMIS_73540Help
Entry
AMIS_73540        CDS       T01795                                 

Definition
(GenBank) putative M20/M25/M40-family peptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00300  Lysine biosynthesis
ams01100  Metabolic pathways
ams01120  Microbial metabolism in diverse environments
ams01230  Biosynthesis of amino acids
Module
ams_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AMIS_73540
Enzymes [BR:ams01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AMIS_73540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAL92574
UniProt: I0HHT7
Position
complement(7975928..7976998)
Genome map
AA seq 356 aa AA seqDB search
MANPLTPDVLVDPVELTRALVDVQSVSRDEKVIADCVEDALRRVAHLTVHRIGNTVMART
ELGRAQRVVLAGHLDTVPINDNWPSTVAEDLIYGCGTSDMKSGVALALHLAATLPDPAYD
ITYLFYEAEEIESEFNGLNLVAGAHPEWLEADFAVLLEPTYGVVEAGCQGTMRVRVHTRG
RRAHTARAWRGVNAIHALGEVLRRLEGYHARTVTIDGCTYREGLSAVRISGGIAGNVVPD
EAWVDVNLRFAPDRSEQQALDHLREIFDGYDLEVTDSAPGALPGLDAAPARDFLGAIGIE
PAAKLGWTDVARFAALGIPALNYGPGDPALAHAPDEHVEIGKIRDGAATLYRWLAP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggccaacccgcttaccccggacgtgctggtagacccggtcgagctgacccgcgccctg
gtcgacgtccagtccgtctcccgcgacgagaaggtgatcgccgactgcgtcgaggacgcc
ctccgcagggtcgcgcacctgaccgtgcaccggatcggaaacaccgtgatggcgcgcacc
gagctcggtcgcgcgcagcgggtcgtgctggccggccacctggacaccgtgccgatcaac
gacaactggccgtccactgtcgccgaggacctcatctacggctgcggcacgtcggacatg
aaatccggggtggccctcgccctgcacctcgcggcgaccctgcccgacccggcgtacgac
atcacctacctcttctacgaggccgaggagatcgagtccgagttcaacgggctgaacctg
gtcgccggcgcgcacccggagtggctggaggccgacttcgcggtgctgctcgaaccgacg
tacggggtggtcgaggcgggctgccaagggacgatgcgggtgcgggtgcacacccgtggc
cggcgggcgcacaccgcgcgggcgtggcgcggggtcaacgcgatccacgcgttgggcgag
gtgctgcggcggctcgagggctaccacgcgcggaccgtgacgatcgacggctgtacgtac
cgggaggggttgagcgcggtccggatctccggtggcatcgccggcaacgtggtgcccgac
gaggcctgggtcgacgtcaacctgcggttcgcgccggaccgttccgagcagcaggccctg
gaccacctgcgcgagatcttcgacgggtacgacctggaggtgaccgactcggcgccgggc
gcgctgcccggactggacgccgcgccggcccgtgacttcctcggtgcgatcgggatcgag
ccggccgcgaagctgggctggaccgacgtggccaggttcgcggcgctcggcatcccggcg
ctcaattacggacccggcgatccggcgctcgcgcacgctcccgacgagcacgtcgagatt
ggcaagatccgggacggggcggccacgctgtaccgctggctggcgccctag

DBGET integrated database retrieval system