KEGG   Actinoplanes missouriensis: AMIS_73540Help
Entry
AMIS_73540        CDS       T01795                                 

Definition
putative M20/M25/M40-family peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ams  Actinoplanes missouriensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ams01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ams00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7975928..7976998)
Genome map
AA seq 356 aa AA seqDB search
MANPLTPDVLVDPVELTRALVDVQSVSRDEKVIADCVEDALRRVAHLTVHRIGNTVMART
ELGRAQRVVLAGHLDTVPINDNWPSTVAEDLIYGCGTSDMKSGVALALHLAATLPDPAYD
ITYLFYEAEEIESEFNGLNLVAGAHPEWLEADFAVLLEPTYGVVEAGCQGTMRVRVHTRG
RRAHTARAWRGVNAIHALGEVLRRLEGYHARTVTIDGCTYREGLSAVRISGGIAGNVVPD
EAWVDVNLRFAPDRSEQQALDHLREIFDGYDLEVTDSAPGALPGLDAAPARDFLGAIGIE
PAAKLGWTDVARFAALGIPALNYGPGDPALAHAPDEHVEIGKIRDGAATLYRWLAP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggccaacccgcttaccccggacgtgctggtagacccggtcgagctgacccgcgccctg
gtcgacgtccagtccgtctcccgcgacgagaaggtgatcgccgactgcgtcgaggacgcc
ctccgcagggtcgcgcacctgaccgtgcaccggatcggaaacaccgtgatggcgcgcacc
gagctcggtcgcgcgcagcgggtcgtgctggccggccacctggacaccgtgccgatcaac
gacaactggccgtccactgtcgccgaggacctcatctacggctgcggcacgtcggacatg
aaatccggggtggccctcgccctgcacctcgcggcgaccctgcccgacccggcgtacgac
atcacctacctcttctacgaggccgaggagatcgagtccgagttcaacgggctgaacctg
gtcgccggcgcgcacccggagtggctggaggccgacttcgcggtgctgctcgaaccgacg
tacggggtggtcgaggcgggctgccaagggacgatgcgggtgcgggtgcacacccgtggc
cggcgggcgcacaccgcgcgggcgtggcgcggggtcaacgcgatccacgcgttgggcgag
gtgctgcggcggctcgagggctaccacgcgcggaccgtgacgatcgacggctgtacgtac
cgggaggggttgagcgcggtccggatctccggtggcatcgccggcaacgtggtgcccgac
gaggcctgggtcgacgtcaacctgcggttcgcgccggaccgttccgagcagcaggccctg
gaccacctgcgcgagatcttcgacgggtacgacctggaggtgaccgactcggcgccgggc
gcgctgcccggactggacgccgcgccggcccgtgacttcctcggtgcgatcgggatcgag
ccggccgcgaagctgggctggaccgacgtggccaggttcgcggcgctcggcatcccggcg
ctcaattacggacccggcgatccggcgctcgcgcacgctcccgacgagcacgtcgagatt
ggcaagatccgggacggggcggccacgctgtaccgctggctggcgccctag

DBGET integrated database retrieval system