KEGG   Actinoplanes missouriensis: AMIS_74810Help
Entry
AMIS_74810        CDS       T01795                                 

Definition
putative thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ams  Actinoplanes missouriensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AMIS_74810
Enzymes [BR:ams01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AMIS_74810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8104636..8105913)
Genome map
AA seq 425 aa AA seqDB search
MSGFAAVDVIRAKRDGHELSDAQIDWVVDAYTRGVVADEQMSALAMAILLRGMTPREIAR
WTAAMIASGERLDLSSVSRPTADKHSTGGVGDKITLPLTPLVAACGVAVPQLSGRGLGHT
GGTLDKLESIPGWRARLSNDEFKSQLQDIGAVICAAGDGLAPADRKLYALRDVTGTVEAI
PLIASSIMSKKIAEGTGALVLDVKVGSGAFMKDLAMAQELARTMVQLGKDSGVTTVALLT
DMSTPLGLAVGNANEVAESVEVLAGGGPADVVELTLALAREMLAAAGVDADPEKALSSGA
AMDSWRAMIRAQGGDPDAPLPTAAHTEVLRASQDGVVTSLDAYGIGIAAWRLGAGRARKE
DPVSFGAGVQLKVRPGDRVRAGDVLLELRADDESRIPVARDEAAAAIVVGTEQPATAGLL
LDRIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggttcgcagctgtcgacgtgatccgggccaagcgggacggtcacgagctctcc
gacgcgcagatcgactgggtggtcgacgcgtacaccaggggtgtggtcgccgacgagcag
atgtccgcgctcgccatggcgatcctgctccgcggcatgacgccgcgggagatcgcccgg
tggaccgccgcgatgatcgccagcggtgagcgcctggacctctcctcggtgtcccggccg
accgccgacaagcactccaccggcggcgtcggcgacaagatcacgctgccgctcaccccg
ctcgtggccgcctgcggcgtggccgtgccgcagctctccggccgcggcctcgggcacacc
ggcggcaccctggacaagctggagtccatccccggctggcgggcgcggctgagtaacgac
gagttcaagtcgcagctgcaggacatcggcgcggtcatctgcgcggccggtgacggtctc
gccccggccgaccgcaagctctacgcgctgcgcgacgtcaccggcacggtcgaggcgatc
ccgctgatcgccagctcgatcatgagcaagaagatcgccgagggcaccggcgcgctggtc
ctggacgtcaaggtcggctccggcgcgttcatgaaggacctggcgatggcccaggagctg
gcccggaccatggttcagctgggcaaggacagcggtgtcaccacggtggcgctgctcacc
gacatgagcacgccgctcggcctggccgtcggcaacgccaacgaggtcgccgagtcggtc
gaggtgctcgccggcggcgggccggccgacgtggtcgagctgaccctggcgctggcccgg
gagatgctcgcggcggccggtgtcgacgccgacccggagaaggcgctctcctcgggcgcg
gccatggacagctggcgggcgatgatccgtgcgcagggcggcgacccggacgcgccgctg
cccacggccgcccacaccgaggtgctgcgtgcctcgcaggacggtgtggtgacgtcgctc
gacgcgtacgggatcggcattgcggcctggcgcctcggcgccggacgggcccgtaaggag
gacccggtcagtttcggcgccggcgtgcagctgaaggttcgccccggtgaccgggtgcgt
gccggtgacgtgctgctggagctgcgggcggacgacgagtcccggatcccggtggcgcgt
gacgaggcggcggcggcgatcgtcgtcggcactgaacagcccgccactgccgggctgctt
ctcgaccgcatagcctga

DBGET integrated database retrieval system