KEGG   Actinoplanes missouriensis: AMIS_74980Help
Entry
AMIS_74980        CDS       T01795                                 

Definition
putative inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ams  Actinoplanes missouriensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ams00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8120886..8121767)
Genome map
AA seq 293 aa AA seqDB search
MGEQTKTSARIAGPRDAGEGGSPPVIDAAFARWLADRAGQELLRVRAEIGYADPKALKAA
GDQAAHDLLKTELARWRPADAVLSEEDEHSRVAWQEGVARPDRLGASRVWIVDPLDGTRE
FSEEGRTDWAVHVALWTADSSNPACLAAGAVAMPAQHRTFATDKPPAYPPMPLESATGGA
IRIAASRTRPPAFVTALAGEIGAELVPMGSAGVKIAAVISGEADAYVHAGGQYEWDSAAP
VAVALATGLHASRIDGTPLAYNQGDPKLPDLVVCRKDLAPRLLAALQKHLPTQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcagacgaagacgtcggcacgcattgcggggccgcgggacgccggcgagggc
ggctcgccgccggtcatcgacgcggccttcgcccgctggctcgcggaccgcgccggccag
gagcttctccgggtccgagccgagatcgggtacgcggatccaaaggctctcaaggccgcc
ggcgaccaggccgcacacgaccttctgaagaccgagctggcccgctggcgacccgctgac
gccgtcctatccgaggaggacgagcactcccgggtggcctggcaggagggcgtcgcccgg
ccggaccgcctgggcgcctcgcgtgtctggatcgtggacccgctggacggcacccgggag
ttctccgaggagggccggaccgactgggccgtgcacgtggcgctctggaccgccgactcg
tccaatccggcctgcctcgcggccggcgcggtggcgatgccggcccagcaccggacgttc
gcgaccgacaagcccccggcgtacccgccgatgccgctggagtcggcgaccggcggggcg
atccggatcgcggcgagccggacccggccgcccgcgttcgtgacggcgctcgccggggag
atcggcgccgagctggtgccgatgggctcggccggtgtgaagatcgccgcagtgatcagt
ggcgaggccgacgcgtacgtgcacgccggcggtcagtacgagtgggactcggccgcgccg
gtcgcggtggccctggccaccgggctgcacgcctcccgcatcgacggcactccgctggcc
tacaaccagggcgacccgaagctacctgacctggtggtctgtcgtaaggatctcgctcct
cggttgcttgctgcgttgcagaagcatcttccgacacaatga

DBGET integrated database retrieval system