KEGG   Actinoplanes missouriensis: AMIS_75310Help
Entry
AMIS_75310        CDS       T01795                                 

Definition
putative UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ams  Actinoplanes missouriensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMIS_75310
   00052 Galactose metabolism
    AMIS_75310
   00500 Starch and sucrose metabolism
    AMIS_75310
   00520 Amino sugar and nucleotide sugar metabolism
    AMIS_75310
Enzymes [BR:ams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AMIS_75310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8156515..8157426)
Genome map
AA seq 303 aa AA seqDB search
MTTNAQGTGRRAVKAVIPAAGLATRFLPATKAVPKELLPVVDRPVLQYIVEEAAAAGITD
VLLVTGRGKTSMVDHFDRRPDVEQRLADKGDTARLEAVRRTSELADIYTVRQGEPLGLGH
AVGTAASHVGPDNAFAVLLGDEFVEESRPLLPQMLDLQAETGGIVLALMEVDPSETSRYG
IASVEKSDEEDIVRITGLVEKPKPEESPSNLAVLGRYVLPGKIFETIADTKPGAGGEIQL
TDAMATLLAEGTPVHGIVYRGHRYDTGMPLGYLQAVVQLAVQRPDLGEEFRAWLTDFVGG
QKG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaacgcgcagggaacaggccggcgcgcggtgaaggcagtgattccggcggca
ggactcgccacccggttcctgccggccaccaaggccgtgccgaaggaactgctgccggtg
gtggaccgccccgtgctgcagtacatcgtcgaagaggcggccgcggccggcatcaccgac
gtcctgctcgtcaccggccggggcaagacctcgatggtggaccacttcgatcgccgcccg
gatgtggagcagcggctcgccgacaagggtgacaccgcccggctcgaagcggtccgccgg
accagcgagctcgccgacatctacacggtccgccagggtgagccgctcggcctcggccac
gcggtcggcaccgccgcctcgcacgtcggcccggacaacgcgttcgcggtgctgctgggc
gacgagttcgtggaggagtcccgccccctcctgccgcagatgctcgatctgcaggcggag
accggcggcatcgtgctcgcgctgatggaggtcgacccctcggagacctcccgctacggc
atcgcctcagtggagaagtccgacgaagaggacatcgtccggatcaccggtctggtcgag
aagcccaagccggaggagtcgccgagcaacctcgccgtcctcggccgctacgtcctcccc
ggcaagatcttcgagacgatcgcggacaccaagcccggcgccggcggcgagatccagctg
accgacgcgatggcgacgctgctcgccgaaggcaccccggtgcacggcatcgtctaccgc
ggccaccggtacgacaccggcatgccgctcggatacctgcaggcggtcgtgcagctggcc
gtccagcgccccgacctcggggaggagttccgggcctggctgaccgacttcgtcggtggt
cagaagggatga

DBGET integrated database retrieval system