KEGG   Actinoplanes missouriensis: AMIS_760Help
Entry
AMIS_760          CDS       T01795                                 

Definition
(GenBank) putative dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00010  Glycolysis / Gluconeogenesis
ams00020  Citrate cycle (TCA cycle)
ams00620  Pyruvate metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01200  Carbon metabolism
Module
ams_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_760
   00020 Citrate cycle (TCA cycle)
    AMIS_760
   00620 Pyruvate metabolism
    AMIS_760
Enzymes [BR:ams01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AMIS_760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: BAL85296
UniProt: I0GX09
Position
complement(84236..85693)
Genome map
AA seq 485 aa AA seqDB search
MTPMSRIKEFNLPDLGEGLTEGEILAWLVKVGDTIELNQPIVEVETAKAAVEIPAKWAGV
VTKIFHEAGTVVEVGKPIISIDTDPGAGPIAEPASAPSAPAAGDDPEAGLIGGPAPGGRT
AVLVGYGPKTTTAKRRPRSGTPATPTNATAATPPAAAPGIPAVPLAMASQETPQPVRPAP
APITATVGGPVLAKPPVRKLARDLGVDLATIIGTGPSGSVTRDDVQKAVAQAVAEPDLTP
APALNGAAETGSREQRIPIKGVRKLTAANMVASAFTAPHVTEFLTVDVTRTVKTLEKLRG
RPEFAEQKISPLLLVAKAVLLAIKRYPMVNSTWSGETGEIIVKEYVNLGIAAATERGLIV
PNVKDAGRLALPELATALNDLIRKARSGKTPPSDMAGGTFSITNVGVYGVDTGTPILPPG
ESAILALGAIRPTPWVHNGKIKIRQVTTLGLSFDHRIIDGELGSKFLRDVGAFLSDPKTA
MLTWG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgatgtcccggatcaaggaattcaacctgcccgacctgggcgaaggcctcacc
gagggcgagatcctggcctggctcgtcaaggtcggcgacacgatcgagctgaaccagccg
atcgtcgaggtggagacggcgaaagcagcagtcgagatccccgccaagtgggccggcgtg
gtcaccaagatcttccacgaggccggcacggtggtcgaggtgggcaagccgatcatctcg
atcgacaccgatcccggcgcgggcccgatcgccgaacccgcatccgccccatccgctccc
gccgcaggtgacgacccggaggccggcctcatcggtggtccggctccgggcggccgcacg
gcggtgctcgtcggttacggcccgaaaaccacaaccgcaaagagaagaccccgatcgggt
acgcctgcgactcccacaaacgcaacggcggccaccccgcctgcggcggctcccggcatc
ccggccgtcccgctcgcgatggcatcgcaggaaacgccgcaacccgtccggcccgcgccc
gccccgatcacggcaaccgtgggtggaccggttctggcgaaaccgccggtccgcaaactg
gcccgggatctcggcgtggacctcgcaacgatcatcggcaccggcccgtccgggtcggtg
acgcgcgacgacgtacagaaggcagtggcgcaagccgtcgccgagccggacctgaccccc
gcgcccgcgctgaacggcgccgcggaaaccgggtcgcgggagcagcggatcccgatcaag
ggagtgcggaagctgaccgcggccaacatggtcgcgtccgcgttcaccgcgccgcacgtc
accgagttcctcacggtcgacgtgacccggaccgtgaagacgctggagaaactgcgcggc
cggcccgagttcgccgagcagaagatctccccgctgctgctcgtggcgaaagccgtgctg
ctcgcgatcaagcgatacccgatggtcaactccacctggtccggcgagaccggcgagatc
atcgtgaaggagtacgtgaacctcggcatcgcggccgcgaccgagcgcgggctgatcgtc
ccgaacgtcaaggacgccggccggctcgccctgccggagctggccaccgcgctcaacgac
ctgatccggaaggcccgctcgggcaagacgccgccgtccgacatggccggcggcacgttc
tcgatcacgaacgtcggcgtgtacggcgtcgacaccggcacgccgatcctgccgcccggc
gagtcggcgatcctggccctcggcgcgatccggccgacaccgtgggtgcacaacggcaag
atcaagattcgccaggtcacgaccctcgggctctccttcgaccaccggatcatcgacggc
gaactgggctcgaagttcctccgggacgtcggcgccttcctctccgacccgaagacggcg
atgctcacctggggatag

DBGET integrated database retrieval system