KEGG   Actinoplanes missouriensis: AMIS_77090Help
Entry
AMIS_77090        CDS       T01795                                 

Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00260  Glycine, serine and threonine metabolism
ams00750  Vitamin B6 metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01230  Biosynthesis of amino acids
Module
ams_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMIS_77090
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AMIS_77090
Enzymes [BR:ams01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AMIS_77090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAL92929
UniProt: I0HIU2
Position
complement(8325033..8326316)
Genome map
AA seq 427 aa AA seqDB search
MTSAVSAPTATPTSPARGLICRACAAEYPLAAQHACYECFGPLEVAYDEAALARVTRAEI
EAGPQNIWRYAALLPAGQDPATRVTLDPGLTPLVSAPALAAAVGLTAPLWVKDDSQNPTH
SFKDRVVSVALTAAQELGFKRFSCASTGNLANSVAAHAARAGVPSIVFIPSDLEQGKIIT
TAVYGGDLVAIEGSYDDVNRLCSELVETDEFEDTAFVNVNVRPFYAEGSKTLGYEVAEQL
GWRIPAQVVVPMASGELLTKIDKAFSELVEIGLVEAPEGGWTVFGAQSAGCNPIATALHN
DTDVITPVKPTGIAKSLNIGDPAAGPYAIEAVKRTGGWMDYADDEEIRAGIRLLAETTGI
FAETAGGTTVAVLKKLVEAGKLDPAKETVVYNTGEGLKTLDAVAGQVGPTHTIKPSLRGA
REAGLLG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctgccgtcagcgcacccactgctacccccacctcccccgctcgcggcctcatc
tgccgcgcctgcgccgcggagtacccgctcgccgcccagcacgcttgttacgagtgtttc
ggcccgctcgaggtcgcgtacgacgaggcggctctcgcgcgggtgacccgggccgagatc
gaggcgggcccgcagaacatctggcgctacgcggcgctgctcccggccgggcaggacccg
gccacccgggtgaccctcgaccccggactgaccccgctggtctccgccccggcgctggcc
gccgcggtcggcctgaccgcgccgctgtgggtgaaggacgactcgcagaacccgacgcac
tccttcaaggaccgggtcgtctcggtggccctgaccgcggcccaggagctgggcttcaag
cggttctcctgcgcctcgaccggcaacctggcgaactcggtggcggcgcacgcggctcgc
gccggtgtgccgagcatcgtgttcatcccgtccgacttggagcagggcaagatcatcacc
accgcggtgtacggcggtgacctggtcgcgatcgagggctcgtacgacgacgtgaaccgt
ctctgcagcgagctggtggagaccgacgagttcgaggacaccgcgttcgtgaacgtgaac
gtgcgcccgttctacgccgagggctccaagaccctggggtacgaggtcgccgagcagctg
ggctggcgtatcccggcgcaggtggtcgtcccgatggcgtccggcgagctgctcaccaag
attgacaaggcgttcagcgagctggtcgagatcggactcgtggaggcgccggagggcggc
tggacggtgttcggcgcccagtcggccggctgcaacccgatcgccacggcgctgcacaac
gacaccgacgtgatcacgccggtgaagccgaccggcatcgcgaagtcgctgaacatcggc
gacccggccgccgggccgtacgcgatcgaggcggtcaagcgcaccggtggctggatggat
tacgccgacgacgaggagatccgcgccggcatccggctgctcgccgagaccaccggcatc
ttcgccgagacggccggtggcaccactgtggccgtactgaagaagctggtggaggccggg
aagctcgatccggccaaggagaccgtcgtctacaacaccggcgagggcctgaagactctg
gacgcggtcgcgggccaggttggaccgacgcacaccatcaagccgtcgctgcgtggcgcg
cgcgaagccggcctgctcggatga

DBGET integrated database retrieval system