KEGG   Actinoplanes missouriensis: AMIS_77190Help
Entry
AMIS_77190        CDS       T01795                                 

Definition
(GenBank) putative sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00010  Glycolysis / Gluconeogenesis
ams00052  Galactose metabolism
ams00500  Starch and sucrose metabolism
ams00520  Amino sugar and nucleotide sugar metabolism
ams00521  Streptomycin biosynthesis
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01200  Carbon metabolism
Module
ams_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMIS_77190
   00052 Galactose metabolism
    AMIS_77190
   00500 Starch and sucrose metabolism
    AMIS_77190
   00520 Amino sugar and nucleotide sugar metabolism
    AMIS_77190
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AMIS_77190
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AMIS_77190
Enzymes [BR:ams01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AMIS_77190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: BAL92939
UniProt: I0HIV2
Position
8337928..8338851
Genome map
AA seq 307 aa AA seqDB search
MTEVVIALDVGGTGMKCALVRPDGTVQHEERHPTRAERGPAAVTENILDVAESLAATARA
AGLTPVATGIAVPGVVDEVTGVAVWSANVGFRDVPLRDLARQRLDMPAALGHDVRVGALA
EARLGAGRGRRHVLFVAIGTGIAAGLVVDGSGYPGAHGAAGELGHVMVRPGGSVCGCGQR
GCLEAESSAKSIGRRYAELSGASEATAFDVATRAAAGEELAGQVWRDAIEALADGLLTAQ
ALYDVGVVVLGGGLAEAGDDLLRPVRAAVAQRITFHRSPEIVRAELGDTAGCLGAALLAL
DSLQGDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtcgtcatcgccctcgacgtcgggggcaccgggatgaagtgcgcgctggtc
cggccggacggcacggtccagcacgaggaacgccatcccacccgggccgagcgtggcccg
gccgcggtcaccgagaacatcctggacgtcgccgagtcgctggccgccacggcacgcgcc
gcaggactcacgccggtggccaccggcatcgccgtgcccggtgtggtcgacgaggtcacc
ggggtggcggtctggtcggcgaacgtgggcttccgggacgtacccctgcgggatcttgcc
cggcagcggctggacatgcccgccgcgctcggccacgacgttcgcgtcggcgccctcgcc
gaagcgcgcctcggcgccggccggggacgccggcacgtgctgttcgtggcgatcggcacc
ggcatcgcggccggcctggtcgtcgacgggtccggctacccgggcgcgcacggcgccgcc
ggcgagctcgggcacgtgatggtccggccgggcggctcggtctgcggctgcggccagcgc
ggctgcctggaggcggagagctcggcgaagtcgatcgggcgacggtacgcggagctgtcc
ggcgcctcggaggccaccgcgttcgacgtggcgacccgggcagcggccggcgaggagctc
gccgggcaggtctggcgggacgcgatcgaggcactcgccgacgggctgctgaccgcgcag
gcgctctacgacgtcggcgtggtggtgctcggcggcggactggccgaggccggtgacgat
ctgctccggccggtacgcgcggcggtcgcccagcggatcacgttccaccgctcgccggag
atcgtccgggccgagctgggtgacacggccggttgtctgggcgcggcgctgctggccctc
gactcgttgcagggagaccgatga

DBGET integrated database retrieval system