KEGG   Actinoplanes missouriensis: AMIS_77860Help
Entry
AMIS_77860        CDS       T01795                                 

Gene name
folK
Definition
putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ams  Actinoplanes missouriensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ams00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8410138..8410665)
Genome map
AA seq 175 aa AA seqDB search
MTRAVLSLGSNLGDRRAHLRSAVALLGDSVTAISGVYETPPWGDAAQPPYLNVVVIVDDA
SATARDWLERARACESAEGRVRDPERRFGPRTLDVDVIDVRSADGTPVTSDDEELTLPHP
RAHLRAFVLRPWLDLEPDAVLPGHGSVAALLDAPETAADLAAMSPRPDQSLESME
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgggccgttctctcgctgggcagcaacctcggtgaccggcgagcccacctgcgg
tccgccgtcgcgcttctgggtgacagcgtcacggcgatctccggcgtctacgagacaccg
ccgtggggggatgcggcgcaacccccgtacctcaatgtggtggtgatcgtggatgacgcg
agcgcgaccgcgcgcgactggctggagcgcgcccgcgcgtgcgaatcggccgaaggccgg
gtgagggacccggaacgccggttcgggccgcggaccctcgacgtcgacgtgatcgatgtc
cgctcggccgacggcacgccggtgaccagcgacgacgaggagctgacgctgccgcatccg
cgtgcgcacctgcgggcgttcgtgctccggccctggctcgatctggaaccggacgcggtg
ctgcccgggcacggatcggtggccgcgctgctggacgcgccggagaccgccgccgacctc
gcggcgatgagcccgcggccggatcagtcgctagagtcgatggagtga

DBGET integrated database retrieval system