KEGG   Actinoplanes missouriensis: AMIS_78030Help
Entry
AMIS_78030        CDS       T01795                                 

Definition
(GenBank) putative GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00790  Folate biosynthesis
ams01100  Metabolic pathways
Module
ams_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMIS_78030
Enzymes [BR:ams01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AMIS_78030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: BAL93023
UniProt: I0HJ36
Position
complement(8426928..8427554)
Genome map
AA seq 208 aa AA seqDB search
MDYLAARLVDGKVTGTPVEDAVDLGRIEKAIREILIAIGEDPDRDGLERTPARVARAYAE
LFAGLRVDPATVLTTTFEADHEELVLVRDIEVQSMCEHHLLPFKGVAHIGYIPGADGRIT
GLSKLARLVEVYARRPQVQERLTSQIADLLMEKLAARGAIVVLECEHLCMEMRGIRKVGA
RTVTSAVRGAFQSDGKVRAEAMALINAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggactatctcgccgcccgtctggtcgacggcaaggtcaccggtacgccggtggaggac
gccgtcgacctcgggcggatcgagaaagcgatccgggagatcctcatcgcgatcggtgag
gacccggatcgtgacggtctcgagcgcactcccgcccgggtcgcccgcgcctacgcggaa
ctcttcgccggcctccgggtcgacccggcgaccgtgctcaccaccaccttcgaggcggac
cacgaggagctcgtgctggtccgtgacatcgaggtgcagagcatgtgcgagcaccacctg
ctcccgttcaagggcgtggcgcacatcgggtacatcccgggcgccgacgggcggatcacc
ggcctgtcgaaactggcccggctcgtcgaggtctacgcccgccgcccgcaggtccaggag
cggctcacctcgcagatcgccgacctgctgatggagaaactcgccgcccgcggcgcgatc
gtggtcctcgagtgcgagcacctctgcatggagatgcgcggcatccgcaaggtcggcgcc
cgcacggtcacctcagcggtgcggggcgccttccagagcgacggcaaggtccgcgccgag
gcgatggccttgataaacgctcgctga

DBGET integrated database retrieval system