KEGG   Actinoplanes missouriensis: AMIS_78030Help
Entry
AMIS_78030        CDS       T01795                                 

Definition
putative GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ams  Actinoplanes missouriensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ams00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8426928..8427554)
Genome map
AA seq 208 aa AA seqDB search
MDYLAARLVDGKVTGTPVEDAVDLGRIEKAIREILIAIGEDPDRDGLERTPARVARAYAE
LFAGLRVDPATVLTTTFEADHEELVLVRDIEVQSMCEHHLLPFKGVAHIGYIPGADGRIT
GLSKLARLVEVYARRPQVQERLTSQIADLLMEKLAARGAIVVLECEHLCMEMRGIRKVGA
RTVTSAVRGAFQSDGKVRAEAMALINAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggactatctcgccgcccgtctggtcgacggcaaggtcaccggtacgccggtggaggac
gccgtcgacctcgggcggatcgagaaagcgatccgggagatcctcatcgcgatcggtgag
gacccggatcgtgacggtctcgagcgcactcccgcccgggtcgcccgcgcctacgcggaa
ctcttcgccggcctccgggtcgacccggcgaccgtgctcaccaccaccttcgaggcggac
cacgaggagctcgtgctggtccgtgacatcgaggtgcagagcatgtgcgagcaccacctg
ctcccgttcaagggcgtggcgcacatcgggtacatcccgggcgccgacgggcggatcacc
ggcctgtcgaaactggcccggctcgtcgaggtctacgcccgccgcccgcaggtccaggag
cggctcacctcgcagatcgccgacctgctgatggagaaactcgccgcccgcggcgcgatc
gtggtcctcgagtgcgagcacctctgcatggagatgcgcggcatccgcaaggtcggcgcc
cgcacggtcacctcagcggtgcggggcgccttccagagcgacggcaaggtccgcgccgag
gcgatggccttgataaacgctcgctga

DBGET integrated database retrieval system