KEGG   Actinoplanes missouriensis: AMIS_78500Help
Entry
AMIS_78500        CDS       T01795                                 

Gene name
recR
Definition
putative recombination and repair protein
Orthology
K06187  
recombination protein RecR
Organism
ams  Actinoplanes missouriensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ams03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8485849..8486442)
Genome map
AA seq 197 aa AA seqDB search
MYEGAIQDLIDELGRLPGVGPKSAQRIAFHILSADPADVNRLAGALRKVKELVRFCTTCF
NVAESDQCRVCRDTRRTNEVLCVVEEPKDVVAIERTGEFRGRYHVLGGAINPLEGVGPDN
LKIRELLIRLGTGEVKELILATDPNTEGEATATYLGLLVKPMGIAVTRLASGLPVGGDLE
YADEITLGRAFEGRRAI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggtgccatccaggacctgatcgatgagctgggccggcttccgggtgttggc
ccgaagtcggctcagcgcatcgcgttccacatcctctccgccgacccggcggacgtgaac
cggctggccggcgctctgcgcaaggtcaaggagctggtgcggttctgcacgacctgtttc
aacgtggccgagtctgatcagtgccgggtctgccgggacacccgccgcaccaacgaggtg
ctctgcgtggtggaggagccgaaggacgtcgtcgcgatcgagcggaccggcgagttccgc
gggcggtaccacgttctcggtggtgcgatcaatccgctcgagggcgtcggcccggacaac
ctgaagatccgcgagctgttgatccggctcgggacgggtgaggtcaaggagctgatcctg
gcgaccgacccgaacacggagggtgaggccaccgcgacctatctcggccttctggtgaag
ccgatgggcatcgccgtgacccgtctggcgagcggtctgccggtcggcggcgatctagag
tacgccgatgagatcaccctcggccgggccttcgagggccgtcgagcgatctga

DBGET integrated database retrieval system