KEGG   Actinoplanes missouriensis: AMIS_79290Help
Entry
AMIS_79290        CDS       T01795                                 

Definition
putative cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ams  Actinoplanes missouriensis
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    AMIS_79290
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     AMIS_79290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8569027..8571294)
Genome map
AA seq 755 aa AA seqDB search
MTSQQTPEQLGRDHYEALVIGSGFGGAVAACRLAQAGVDVAIIERGRRWRPGDFPRDLSR
LDDGWLWMCGHGLYDAMPLNDILAVRAAGYGGGSLVYANVAMRAPAEVFDDRWPAPYTRQ
TLDPYYDLASAMLNVRPVPADPRTGVLPPKTRLMARAADDLGHSEGFFHPNLAVTFDDEG
PGQTNPFGVPQRGCTFCGECDIGCNVGAKNSLDLNYLALAEKHGATVGVRTEAVYIARTD
EGYRVRLREHGHPGSSVERDVTARYVFLCAGALGSTELLLRSRDQYGTLPDLPETLGSRY
SGNGDFLSFGQGLTEAFVPHSGPTITTASLIRSGESDREHWFVLEDGGFSEHLARLVRTL
HLSRLPAQVAQTIGVGTQRVLTATRAMAARLDDEPDDTAVLLAMGRDRADGRISLSRRTK
RLRVTWDVTRNDPLYTEEQSISGAVVRAFGGRPFTTPTWRLFRQPVTVHNLGGAPMGDGP
DTGVVDPDGEVFGHPGLYVLDGGALPGATGGNPSLTIAAVAERCIEIAVRRITGDPGWTA
PELARAVRGPVPEDEAVRAVTARGPRPPAGRGLRFTETMRGRLRPDTGAQEVVLRLTVSI
PDFRTFLDDPVHAAQVSGTVRVEGLTTAPVAVRDGVLHLLAPVGGGTERSMDYVLPFTDD
EGREWLLQGVKKVGRRHGLHPWRATTRLQIALTRPEERYDAVPIGSAAIAFRDVLRMLGA
VRPTGARRLTTVLRFGGFFAKRVVSAYLPTLIDLP
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcagcagacccccgaacaactcggccgcgatcactacgaggcactggtgatc
ggcagtgggttcggcggagccgtcgccgcctgccggctcgcccaggccggcgtcgatgtg
gcgatcatcgagcgcggccggcgctggcggcccggcgacttcccccgcgacctgtcgcgc
ctggacgacggctggttgtggatgtgcgggcacggcctctacgacgcgatgccgctcaac
gacatcctcgccgtccgagccgcggggtacggcgggggatcgctcgtctacgcgaacgtc
gccatgcgggcgcccgcggaggtcttcgacgaccgctggcctgcgccgtacacccggcag
acgctcgacccgtactacgacctcgcgtccgccatgctgaacgtgcgaccggtccccgcg
gatccccgtaccggtgtgttgccgccgaagacacgcctgatggcgcgggcagccgacgac
ctcggtcactccgagggtttcttccatcccaatctcgccgtgacgttcgacgacgagggc
cccggacagaccaacccgttcggcgtcccgcagcgcggctgcacgttctgcggagaatgc
gacatcggctgcaacgtcggtgcgaagaactcgctcgacctcaactacctcgcactcgcc
gagaagcacggtgcgaccgtgggagtgcggaccgaggcggtgtacatcgcccgtaccgat
gagggttaccgggtccggttgcgggagcacgggcatccgggcagcagcgtcgagcgtgac
gtcacggcgcggtacgtcttcctctgtgcgggcgcgctcggcagcaccgagctgctgctg
cgcagccgggaccagtacggcaccctgccggacctgcccgagacgctgggcagccggtac
tccggcaacggcgacttcctcagcttcgggcaggggctcaccgaggcgttcgtcccgcac
agcggaccgacgatcaccaccgcgtcattgatccgcagcggcgagtcagaccgtgagcac
tggttcgtgctggaggacggcggattctccgaacacctcgcgcggctggtccgcaccctt
cacctgtcccggctacccgctcaggtggcacagacgatcggcgtcggcacgcagcgggtg
ctcacggccacccgagcgatggcggcgaggctggacgacgagccggacgacaccgcggtg
ctgctcgccatgggccgggatcgcgcggacggccggatctcgttgtcccgccgcacgaag
cggctgcgcgtgacctgggacgtgacccgcaacgacccgctctacaccgaggagcagagc
atctccggcgcggtggtccgcgcgttcggcgggcggccgttcaccacacccacctggcgg
ctgttccggcagccggtgaccgtgcacaacctcggcggcgccccgatgggcgacggcccc
gacaccggtgtcgtcgatcccgacggcgaggtcttcgggcatcccggcctctacgtgctg
gacggcggcgccctgcccggcgcgaccggcggcaacccgtcgctgaccatcgccgcggtg
gccgagcgatgcatcgagatcgcggtccgccggatcaccggcgatccggggtggaccgcg
ccggagctcgcccgggcggtccgtggcccggttcccgaggacgaggcggtccgggcggtg
accgcccgcggcccgcgcccgccggccgggcgcggactgcgattcaccgagaccatgcgc
ggccggctccggccggacaccggtgcacaagaggtggttctgcgactgacggtcagcatt
ccggacttccgaacgttcctcgacgacccggtgcacgccgcgcaggtcagcggcacggtg
cgagtcgaggggctgacgacggccccggttgccgtgcgggacggcgtcctgcacctgctc
gccccggtcggcggcgggaccgagcggtcgatggactacgtcctgcccttcaccgatgac
gaggggcgtgagtggctactgcagggtgtcaagaaggtcggccgtcggcacggcctccac
ccgtggcgggcgacgacccggctgcagatcgcgttgacccggccggaggagcggtacgac
gccgtgccgatcggcagcgccgcgatcgcgttccgcgatgtcctccggatgctcggcgcc
gtccggcccaccggcgcccgcaggctcaccacggtcctgagattcggtgggttcttcgcg
aagagagtggtctccgcctacctgccgaccctcatcgacctgccctga

DBGET integrated database retrieval system