KEGG   Actinoplanes missouriensis: AMIS_8420Help
Entry
AMIS_8420         CDS       T01795                                 

Definition
putative glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ams  Actinoplanes missouriensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AMIS_8420
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AMIS_8420
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AMIS_8420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
901867..903720
Genome map
AA seq 617 aa AA seqDB search
MRSFLAATAGGLLAATALVASPASPALAAGETVNVYLTTTSDSGGRTVTRGLQQQAAINF
GPAGGSANQTITVNEGVTYQTFEGGGASITDTTAYLMRGGPISAATRDAVMTKLFSPTEG
IGLSFVRNPIGASDLSRPGNVSLDDTCCDLNDFGANGYDTDVRLLTQQARRLNPALRVKG
VPWSAPGWMKDNGRMDQMGWLKWEHYPTYAQYLVKYIQSYQAAGVPVNYISVQNEPNCCQ
ASNPAAMNYPGMSWNPAGLVEFTKNFVYPAFRAAGITTKVLIHDWNYGDYANFGAAILAD
PGVRNDPLFGGIAWHGYFGDPAVGSQVHDTYPAVRQFSTEHSGGTWIANQHNEDLADIVS
YARNWSGSLVKWSLALNQNMGPHNGGCGTCTGLITVQEGGSRAGQVDYTVEYYTTGHLTK
FVKPGAVRIESNNTAVQNVAWRNPDGSKALIAHNGGTSAQSVRVNWANQSFVYTLPARTT
ATFTWAGAGATQNAITGLAGKCVDVAGAAAANGTAIQLYTCNGTAAQQWTRASDGTLRSL
GKCLDISGPSSSDGTPAHLWDCHSGSSQQWAYDTATQRLTNGYSGKCLDVTGNNSADGTR
LQIWTCGGGANQKWVLK
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgttcctcgcagcgacggccggtggtctgctggccgccaccgccctcgtcgca
tcccccgcgtctcccgcgctcgccgccggcgagaccgtcaacgtctacctcaccaccaca
tcggacagcggcggccgcaccgtgacccgcggcctccagcagcaggccgcgatcaatttc
ggcccggccggtggctccgccaaccagacgatcaccgtgaacgagggcgtcacctaccag
accttcgagggcggtggcgcgtcgatcaccgacaccaccgcgtacctgatgcgtggcggc
ccgatcagcgcggccacccgggacgccgtgatgaccaagctgttcagccccaccgagggg
atcggtctctcgttcgtccgcaatccgatcggcgcctccgacctgtcccggcccggcaac
gtctcgctcgacgacacctgctgcgacctgaacgatttcggcgccaacgggtacgacacc
gacgtccggctgctcacccagcaggcccgccggctcaacccggcgctacgggtcaagggc
gtcccgtggagcgcgcccggctggatgaaggacaacggccggatggaccagatgggctgg
ctgaagtgggagcactacccgacgtacgcccagtacttggtcaagtacatccagagctac
caggccgccggtgtgccggtgaactacatatcggtgcagaacgagccgaactgctgccag
gcgtccaacccggcggcgatgaactacccgggtatgagctggaacccggccggcctggtc
gagttcaccaagaacttcgtctacccggcgttccgggcagccgggatcaccacgaaggtg
ctgatccacgactggaactacggcgactacgcgaacttcggggcggccatcctcgccgac
ccgggcgtacgcaacgatccgctcttcgggggcatcgcctggcacgggtacttcggtgac
ccggcggtcggctcgcaggtgcacgacacgtacccggcggtcaggcagttcagcaccgag
cactccggcggcacctggatcgccaaccagcacaacgaggacctcgccgacatcgtcagc
tacgcccggaactggagcggcagcctggtcaagtggagcctcgcgctgaaccagaacatg
ggaccgcacaacggcggctgcggcacctgcaccgggctgatcaccgtgcaggagggcggc
agccgggccggtcaggtcgactacaccgtcgagtactacacgaccgggcacctcacgaag
ttcgtgaagccgggcgcggtccggatcgagtcgaacaacaccgcggtgcagaacgtggcc
tggcgcaacccggacggctccaaggcgctgatcgcgcacaacggcgggacgtcggcgcag
tcggtgcgggtcaactgggcgaaccagtccttcgtctacacgcttccggcccggaccacc
gccacgttcacctgggcgggcgccggcgccacgcagaacgcgatcaccggcctggccggc
aagtgcgtcgacgtcgccggcgcggcggccgccaacgggaccgcgatccagctctacacc
tgcaacggaaccgccgcgcagcaatggacgcgcgcgtccgacgggacgctgcgctcgctc
ggcaagtgcctcgacatcagcggcccgagcagctcggacggcacacctgcgcacctctgg
gactgccacagcggttcgtcgcagcagtgggcctacgacaccgcgacccagcggctcacc
aacggatattccggcaaatgtctggacgtcacaggtaacaactccgcggacgggacacgt
cttcagatctggacctgcggcggtggggccaaccagaaatgggtgctcaagtga

DBGET integrated database retrieval system