KEGG   Alkaliphilus metalliredigens: Amet_0039Help
Entry
Amet_0039         CDS       T00551                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amt01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:amt00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(59604..60812)
Genome map
AA seq 402 aa AA seqDB search
MKNLVDWKGFIHQYYDEEELVKLTQDLIKIPSHVNYPGREKEVGIFLSDYCQRQGFDVEV
KTIVDERVNVIVTLKGTGEGKTLLLNGHLDTVPPGEMDFDPYGAEIVDGHILGRGTVDMK
GPIASMIIMMLALKRSDLKLTGDIIFTGVIGEEEQSEGTEDLVKNGIKADGAIVGEPSSS
QYSAGHRGLEWLEIKIKGRSAHGGVPHLGINAIEKAGKLISAIQDTIYPKLEKRSHPLMG
PSVMNFGYIKGGIQPSTVAGDCIIQIDRRYIPGETVATVIAEYQEVIDHLKAHDSDFDAE
IIRMPNNMLTLDHLPLETSLDDPITVALKNALSAVLEREPVLSTKRGWTDASLLYNFANI
PTIVYGPGDISYSHTKNEQIAIKELIEAVEVYFLTALQFCGN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttagttgattggaaggggttcattcatcaatattacgacgaagaagaactc
gttaagcttacacaggatttaatcaaaatacctagtcatgttaactatcctggtcgagaa
aaggaggttggcatttttttatctgattattgtcaaaggcagggctttgatgtagaggta
aaaaccattgtagatgagcgggtcaatgtcattgttactttaaagggaactggtgaaggt
aagacattactgttaaatggtcatttagatactgtacctcctggagaaatggattttgat
ccctatggtgctgaaattgtcgatgggcatatcttaggtcggggtacagtagatatgaag
ggtcctattgcttctatgattatcatgatgctcgctttaaaacgttcagatcttaaatta
acaggtgacattatattcactggggtgattggtgaagaggagcagagtgaagggacagag
gatcttgttaaaaatggtattaaggcagatggtgcaattgtaggagagccctctagctct
caatactccgctggccatcgtggtctagagtggctggaaattaaaataaaaggtaggtca
gcccatggtggtgttccccatcttggtatcaatgccatagaaaaggctggaaaactaatt
agtgctatccaggatacaatttatcctaagctagagaaaagaagccatcctttgatgggc
ccctctgttatgaatttcggttatattaaaggtggcatacagcctagcaccgtagctggt
gattgtatcatacagattgatagacgttatattcccggagaaacagttgcaacggttatt
gctgaataccaagaggttattgatcatctcaaggctcatgattcagattttgatgctgaa
attataagaatgcctaacaatatgctcaccctagatcatctacctttagaaacaagttta
gatgaccctatcactgtggctctaaaaaacgctttatctgctgtgctagaaagagagcct
gtgctatcgacaaaacgaggctggacagatgcttctttgttatataattttgctaatatc
ccaaccattgtttatgggccaggagatattagctattcccatactaaaaatgagcagatt
gccattaaagaattaattgaggctgtggaggtctatttcttaaccgctttacagttttgt
ggaaattaa

DBGET integrated database retrieval system