KEGG   Alkaliphilus metalliredigens: Amet_0061Help
Entry
Amet_0061         CDS       T00551                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
amt  Alkaliphilus metalliredigens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Amet_0061
Enzymes [BR:amt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Amet_0061
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Amet_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
82626..84134
Genome map
AA seq 502 aa AA seqDB search
MSKGYVYLVGAGPGDEELITVKGLRCIQEADVILYDRLANPALLKNKRDEAECIDVGKSP
KRHAYTQEEINELLVLQAHKGKTVTRLKGGDPYVFGRGGEEALALRKARIPFEVVPGITS
AIAVPNYGGIPVTHRNVSTSFHVITGHEDPLKEKSSVNYEALAKLEGTLVFLMGVGNLEE
IVNQLRRYGKPKETPIALVHQGTTAKQRTVTGTLESIVTVVKEKKITSPSVIVIGEVVRL
QDELNWFESLPLHGQRILVTRTREQASQLSTKLKALGGDVVEYPTIEIRPAQDIEGVNAK
LKRIHQGDYIIFTSVNGVKAFFERLKALKMDVREMGPGKLVAIGPATAKALEEKGLLVEV
IPETYVAEGIIDCLKESIKEGDKVFLPRANIARKALNEGLEALGAQVEEIEIYETVLPVQ
GEQHLRELLVEGIDWITFTSSSTVQNFMDLLGKEDRHLLESVKIASIGPITGKTAKKLGL
PVDVQAKEYTIAGLVQAMMEVQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagggttacgtctatttagtaggggcaggtccaggagatgaagaactgatcaca
gtaaagggattgcgctgtatccaagaggctgatgtcattttatatgatcggttggccaat
ccagcccttttaaagaataaaagagacgaggcagaatgcatagatgtagggaagtctcca
aaacgccatgcctatacccaagaggaaatcaatgaactattggtgcttcaggctcataaa
ggcaagacggtgacccgactaaaggggggagatccctatgtttttggcaggggtggagaa
gaggccctggcccttagaaaagcacggattccctttgaagtggtgccgggtattacttcc
gccattgctgtaccaaactatggtgggattccagtgacccacagaaatgtcagcacttct
tttcatgtcattacaggccatgaagatcccctgaaggaaaaatccagtgtcaattatgaa
gccctggcaaagctagaggggactttggtatttttaatgggggtaggtaatttagaggag
attgttaatcaattacggagatatggaaagccaaaggagacacccattgcactggttcat
caaggcaccacagcaaaacaaaggactgtcacaggcaccctggaaagcattgtaacagtg
gtcaaggaaaagaaaatcacctcgccatcggtcattgtgattggggaagtcgttagactt
caggatgaactcaattggtttgagtccctaccacttcacggtcaaagaatattggtgacc
cgaacccgagaacaagccagtcaactttccactaagcttaaggcattaggaggagatgtg
gtagaatatcccacaatcgaaattcgcccagcccaggatattgaaggggtcaatgcaaag
cttaaacgaattcaccaaggggattacattatttttacaagcgtcaatggggttaaggca
ttttttgaaagactgaaggcgctgaaaatggacgtaagagaaatgggtccaggaaaattg
gtagccattggacctgcaacggctaaggccttggaggaaaaaggtcttttggttgaagtg
attcccgaaacctatgtggcggaaggaattattgattgccttaaggaaagcattaaagaa
ggagataaggtgtttttaccccgggcaaacattgctcgaaaggcactgaatgaggggcta
gaggcactgggagcacaggtggaggaaatcgaaatttatgaaactgtcctaccggtccaa
ggagagcagcacctaagggagctattagtagaggggattgattggattacatttacaagt
tcttctactgtccaaaattttatggatttactggggaaagaagaccgacatttacttgag
agtgttaaaattgcttccattggacccattacgggaaagaccgcaaaaaaactaggctta
ccagtggatgtacaggccaaggaatataccatagcaggactggttcaagccatgatggag
gtacaatag

DBGET integrated database retrieval system