KEGG   Alkaliphilus metalliredigens: Amet_0295Help
Entry
Amet_0295         CDS       T00551                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00040  Pentose and glucuronate interconversions
amt00052  Galactose metabolism
amt00500  Starch and sucrose metabolism
amt00520  Amino sugar and nucleotide sugar metabolism
amt01100  Metabolic pathways
amt01130  Biosynthesis of antibiotics
Module
amt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amet_0295
   00052 Galactose metabolism
    Amet_0295
   00500 Starch and sucrose metabolism
    Amet_0295
   00520 Amino sugar and nucleotide sugar metabolism
    Amet_0295
Enzymes [BR:amt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Amet_0295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD FemAB_like
Motif
Other DBs
NCBI-ProteinID: ABR46527
JGI: Amet0295
UniProt: A6TK09
Position
334816..335745
Genome map
AA seq 309 aa AA seqDB search
MMKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAVASGIEEILIITGRN
KKSIEDHFDKSVELELELESKGKTELLEEVRKISDMVNIHYIRQKEPKGLGHAIHCAKSF
IGNEPFAVLLGDDIVDAPKPCLKQMIDAYNEYKTSILGVQEVPWEDVNKYGIVKGMHIED
RIYKVKDLIEKPAVNEAPSNVAILGRYIITPNIFEILENTPPGKGGEIQLTDALRVLAQK
EAMYAYHFEGRRYDVGDKQGFLEATVEFALKREDLREDFLAYLQKITRREVEREQTQVQV
QEVAMTDKE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggtaaaaaaagccattattccagcggcggggctagggacacgttttctaccg
gctactaaagcgcaaccaaaggaaatgctacccattgtggataaaccaacactgcaatat
attattgaagaagccgtggcttctgggattgaagagattttgattattacaggtcgaaat
aaaaagtccattgaagatcactttgataagtctgtggagttagagctagagcttgaaagc
aagggtaagacagagctgttagaggaagtacgtaagatttcagatatggtgaatatccat
tacattcgtcaaaaggaaccaaagggcctaggacatgccatccactgtgccaaaagcttt
attggcaatgagccatttgcagttttactgggggatgacatcgtggatgcacctaagcct
tgtctaaagcagatgattgatgcctacaatgaatacaaaaccagtattttaggtgttcag
gaagttccatgggaagacgttaataaatatgggattgttaagggaatgcatattgaggat
cgaatctataaggtgaaggatttgatagaaaaaccagctgtgaatgaggcaccttctaat
gtggccatcctgggaagatatattatcacaccaaatattttcgaaattctagagaatacc
ccaccaggcaaaggaggagaaattcaattaaccgatgccctaagggtattggctcaaaaa
gaggccatgtatgcctatcattttgaaggaagaagatatgatgtaggggataagcagggc
tttttagaagctactgtggagtttgcattaaagagagaagatctcagagaagatttctta
gcttacttacaaaagattacacgtcgggaagtagaacgtgaacaaacccaggtacaagtt
caagaagtggccatgacagataaggaataa

DBGET integrated database retrieval system